US2006040278A1PendingUtilityA1
Novel nucleotide and amino acid sequences, and assays and methods of use thereof for diagnosis of ovarian cancer
Est. expiryJan 27, 2024(expired)· nominal 20-yr term from priority
Inventors:Gad S. CojocaruSarah PollockZurit LevineAlexander DiberGuy KolAmir ToporikRotem SorekDvir DaharyMichal Ayalon-SofferPinchas AkivaAmit NovikYossi CohenOsnat Sella-TavorShira WalachShirley Sameah-GreenwaldRonen ShemeshMaxim Shklar
G01N 33/57545C12Q 1/6886C12Q 2600/158C12Q 2600/112
43
PatentIndex Score
0
Cited by
0
References
0
Claims
Abstract
Novel markers for ovarian cancer that are both sensitive and accurate. These markers are overexpressed and/or differentially expressed in ovarian cancer specifically, as opposed to normal ovarian tissue. The measurement of these markers, alone or in combination, in patient samples provides information that the diagnostician can correlate with a probable diagnosis, in ovarian cancer. The markers of the present invention, alone or in combination, show a high degree of differential detection between ovarian cancer and non-cancerous states.
Claims
exact text as granted — not AI-modified1 . An isolated polynucleotide comprising a polynucleotide having a sequence of R11723_PEA — 1_T5 (SEQ ID NO. 114).
2 . The isolated polynucleotide of claim 1 , comprising a node having a sequence of: R11723_PEA — 1_node — 13 (SEQ ID NO. 116).
3 . An isolated polypeptide comprising a polypeptide having a sequence of: R11723_PEA — 1_P13 (SEQ ID NO. 145).
4 . The isolated polypeptide of claim 3 , comprising a chimeric polypeptide encoding for R11723_PEA — 1_P13 (SEQ ID NO. 145), comprising a first amino acid sequence being at least 95% homologous to MWVLGIAATFCGLFLLPGFALQIQCYQCEEFQLNNDCSSPEFIVNCTVNVQDMCQKEVMEQSA corresponding to amino acids 1-63 of Q96AC2 (SEQ ID NO. 969), which also corresponds to amino acids 1-63 of R11723_PEA — 1_P13 (SEQ ID NO. 145), and a second amino acid sequence being at least about 95% homologous to a polypeptide having the sequence DTKRTNTLLFEMRHFAKQLTT (SEQ ID NO: 1130) corresponding to amino acids 64-84 of R11723_PEA — 1_P13 (SEQ ID NO. 145), wherein said first and second amino acid sequences are contiguous and in a sequential order.
5 . The isolated polypeptide of claim 4 , comprising a tail of R11723_PEA — 1_P13 (SEQ ID NO. 145), comprising a polypeptide being at least about 95% homologous to the sequence DTKRTNTLLFEMRHFAKQLTT (SEQ ID NO: 1130) in R11723_PEA — 1_P13 (SEQ ID NO. 145).
6 . The isolated polynucleotide of claim 1 , comprising an amplicon according to SEQ ID NO: 975.
7 . A primer pair, comprising a pair of isolated oligonucleotides capable of amplifying said amplicon of claim 6 .
8 . The primer pair of claim 7 , comprising a pair of isolated oligonucleotides: SEQ NOs 973 and 974.
9 . An antibody capable of specifically binding to an epitope of an amino acid sequence of claim 3 .
10 . The antibody of claim 9 , wherein said amino acid sequence comprises said tail of claim 4 .
11 . The antibody of claim 9 , wherein said antibody is capable of differentiating between a splice variant having said epitope and a corresponding known protein PSEC.
12 . A kit for detecting ovarian cancer, comprising a kit detecting overexpression of a splice variant according to claim 1 .
13 . The kit of claim 12 , wherein said kit comprises a NAT-based technology.
14 . The kit of claim 12 , wherein said kit further comprises at least one primer pair capable of selectively hybridizing to a nucleic acid sequence according to claim 1 .
15 . The kit of claim 12 , wherein said kit further comprises at least one oligonucleotide capable of selectively hybridizing to a nucleic acid sequence according to claim 1 .
16 . A kit for detecting ovarian cancer, comprising a kit detecting overexpression of a splice variant according to claim 3 , said kit comprising an antibody according claim 9 .
17 . The kit of claim 16 , wherein said kit further comprises at least one reagent for performing an ELISA or a Western blot.
18 . A method for detecting ovarian cancer, comprising detecting overexpression of a splice variant according to claim 1 .
19 . The method of claim 18 , wherein said detecting overexpression is performed with a NAT-based technology.
20 . A method for detecting ovarian cancer, comprising detecting overexpression of a splice variant according to claim 3 , wherein said detecting overexpression is performed with an immunoassay.
21 . The method of claim 20 , wherein said immunoassay comprises an antibody according to claim 9 .
22 . A biomarker capable of detecting ovarian cancer, comprising a nucleic acid sequence according to claim 1 or a fragment thereof, or an amino acid sequence according to claim 3 or a fragment thereof.
23 . A method for screening for ovarian cancer, comprising detecting ovarian cancer cells with a biomarker according to claim 22 .
24 . A method for diagnosing ovarian cancer, comprising detecting ovarian cancer cells with a biomarker according to claim 22 .
25 . A method for monitoring disease progression and/or treatment efficacy and/or relapse of ovarian cancer, comprising detecting ovarian cancer cells with a biomarker according to claim 22 .
26 . A method of selecting a therapy for ovarian cancer, comprising detecting ovarian cancer cells with a biomarker according to claim 22 and selecting a therapy according to said detection.Cited by (0)
No later patents cite this yet.
References (0)
No backward citations on record.