US2008063651A1PendingUtilityA1
Fibronectin derivative Fc fusions
Est. expiryDec 10, 2018(expired)· nominal 20-yr term from priority
C12Q 1/00C07K 16/00C07K 14/525C12N 15/1037C07K 2317/22C07K 2319/30C40B 40/02C07K 14/78C07K 16/241C07K 2318/20C07K 2319/00C07K 14/47
71
PatentIndex Score
0
Cited by
0
References
0
Claims
Abstract
Disclosed herein are proteins that include an immunoglobulin fold and that can be used as scaffolds. Also disclosed herein are nucleic acids encoding such proteins and the use of such proteins in diagnostic methods and in methods for evolving novel compound-binding species and their ligands.
Claims
exact text as granted — not AI-modified1 . A pharmaceutical composition comprising a therapeutic protein comprising a tenth domain of fibronectin type III ( 10 Fn3) and a physiologically acceptable carrier, wherein the 10 Fn3 domain: (a) has at least one loop with a modified amino acid sequence relative to the sequence of the corresponding loop of a human 10 Fn3 domain, the loop selected from the group of the BC loop, the DE loop and the FG loop; and (b) binds to a target compound that is not bound by the corresponding human 10 Fn3 domain; wherein the therapeutic protein further comprises an Fc region of an antibody, and wherein the pharmaceutical composition is substantially free of endotoxin.
2 . The pharmaceutical composition of claim 1 , wherein the 10 Fn3 domain has at least two loops with a modified amino acid sequence relative to the sequence of the corresponding loop of a human 10 Fn3 domain.
3 . The pharmaceutical composition of claim 1 , wherein the 10 Fn3 domain has at least three loops with a modified amino acid sequence relative to the sequence of the corresponding loop of a human 10 Fn3 domain.
4 . The pharmaceutical composition of claim 1 , wherein at least one of the modified loops in the 10 Fn3 domain is extended in length relative to the corresponding loop of a human 10 Fn3 domain.
5 . The pharmaceutical composition of claim 1 , wherein the DE loop is extended by 10-13 amino acid residues relative to the corresponding loop of a human 10 Fn3 domain.
6 . The pharmaceutical composition of claim 1 , wherein the integrin binding motif, RGD, of the 10 Fn3 domain is replaced by an amino acid sequence as follows: basic amino acid-neutral amino acid-acidic amino acid.
7 . The pharmaceutical composition of claim 1 , wherein the Fc region is an IgG constant region.
8 . The pharmaceutical composition of claim 1 , wherein the 10 Fn3 domain binds with a K D of 500 nM or less to the target compound.
9 . The pharmaceutical composition of claim 1 , wherein the 10 Fn3 domain binds with a K D of 10 nM or less to the target compound.
10 . The pharmaceutical composition of claim 1 , wherein the 10 Fn3 domain contains no free sulfhydryl moieties and no disulfide bonds.
11 . The pharmaceutical composition of claim 1 , wherein the 10 Fn3 domain has an amino acid sequence that is at least 70% identical to the sequence of a human 10 Fn3 domain.
12 . The pharmaceutical composition of claim 1 , wherein the at least one modified loop is randomized.
13 . The pharmaceutical composition of claim 11 , wherein the 10 Fn3 domain is identified by a screening method comprising: (i) contacting the target compound with a candidate polypeptide having an 10 Fn3 domain comprising at least one randomized loop under conditions that allow target compound-polypeptide complex formation; and (ii) obtaining the polypeptide which binds to the compound.
14 . The pharmaceutical composition of claim 13 , wherein the screening method further comprises: (iii) repeating (i) and (ii) using a further randomized 10 Fn3 domain.
15 . A pharmaceutical composition comprising a protein comprising a tenth domain of fibronectin type III ( 10 Fn3) and a physiologically acceptable carrier, wherein the 10 Fn3 domain: (a) has 5 or more amino acid changes from the amino acid sequence VSDVPRDLEVVAATPTSLLISWDAPAVTVRYYRITYGETGGNSPVQEFTVPGSKS TATISGLKPGVDYTITVYAVTGRGDSPASSKPISINYRT (b) binds to a target compound that is not bound by the corresponding human 10 Fn3 domain; wherein the protein further comprises an Fc region of an antibody, and wherein the pharmaceutical composition is substantially free of endotoxin.
16 . The pharmaceutical composition of claim 15 , wherein the 10 Fn3 domain has 10 or more amino acid changes from the amino acid sequence
VSDVPRDLEVVAATPTSLLISWDAPAVTVRYYRITYGETGGNSPVQEFTV
PGSKSTATISGLKPGVDYTITVYAVTGRGDSPASSKPISTNYRT.
17 . A pharmaceutical composition comprising a protein comprising a tenth domain of fibronectin type III ( 10 Fn3) and a physiologically acceptable carrier, wherein the 10 Fn3 domain: (a) is at least 70% identical to amino acid sequence VSDVPRDLEVVAATPTSLLISWDAPAVTVRYYRITYGETGGNSPVQEFTVPGSKS TATISGLKPGVDYTITVYAVTGRGDSPASSKPISINYRT (b) binds to a target compound that is not bound by the corresponding human 10 Fn3 domain; wherein the protein further comprises an Fc region of an antibody, and wherein the pharmaceutical composition is substantially free of endotoxin.Join the waitlist — get patent alerts
Track US2008063651A1 — get alerts on status changes and closely related new filings.
We store only your email — no account needed. See our privacy policy.