US2011086372A1PendingUtilityA1

Biomarkers associated with nephropathy

51
Assignee: IND TECHNOLOGY RES INST ITRIPriority: Jan 28, 2009Filed: Dec 20, 2010Published: Apr 14, 2011
Est. expiryJan 28, 2029(~2.5 yrs left)· nominal 20-yr term from priority
Inventors:Mary Ya-Ping YehTzu-Ling TsengChing-Fang LuWei-Ya LinTsai-Wei HsuYi-Ting ChenChwei-Shiun Yang
G01N 33/6893C07K 14/70503G01N 2333/4728G01N 2333/70503G01N 2800/347G01N 2800/52G01N 2800/56C07K 16/2803
51
PatentIndex Score
0
Cited by
0
References
0
Claims

Abstract

Use of urine biomarkers for diagnosing nephropathy, monitoring nephropathy progress, and assessing efficacy of a nephropathy treatment. These urine biomarkers include leukocyte-associated Ig-like receptor-2, alpha-1 acid glycoprotein, their fragments, and combinations thereof.

Claims

exact text as granted — not AI-modified
1 . An isolated antibody specifically binding to DFLELLVKGTVPGTEASGFDAP, or GQEHFAHLLILRDTKTYMLAFDVNDEKNWGLS. 
     
     
         2 . The antibody of  claim 1 , specifically binding to DFLELLVKGTVPGTEASGFDAP. 
     
     
         3 . The antibody of  claim 1 , specifically binding to GQEHFAHLLILRDTKTYMLAFDVNDEKNWGLS. 
     
     
         4 . The antibody of  claim 1 , wherein the antibody is a monoclonal antibody. 
     
     
         5 . The antibody of  claim 1 , wherein the antibody is a whole immunoglobulin molecule. 
     
     
         6 . The antibody of  claim 1 , wherein the antibody is a single-chain antibody, a chimeric antibody, or a humanized antibody. 
     
     
         7 . A kit for diagnosing nephropathy, comprising a first antibody specifically binding to leukocyte-associated Ig-like receptor-2 and a second antibody specifically binding to alpha-1 acid glycoprotein. 
     
     
         8 . The kit of  claim 7 , wherein the first and second antibodies are whole immunoglobulin molecules. 
     
     
         9 . The kit of  claim 7 , wherein the first and second antibodies are monoclonal antibodies. 
     
     
         10 . The kit of  claim 7 , wherein the first antibody specifically binds to DFLELLVKGTVPGTEASGFDAP. 
     
     
         11 . The kit of  claim 7 , wherein the second antibody specifically binds to GQEHFAHLLILRDTKTYMLAFDVNDEKNWGLS. 
     
     
         12 . The kit of  claim 7 , wherein the first antibody specifically binds to DFLELLVKGTVPGTEASGFDAP, and the second antibody specifically binds to GQEHFAHLLILRDTKTYMLAFDVNDEKNWGLS. 
     
     
         13 . The kit of  claim 7 , consisting essentially of the first antibody and the second antibody. 
     
     
         14 . The kit of  claim 7 , further comprising reagents and materials for an immunoassay, the immunoassay being ELISA, Westernblot, RIA, FIA or LIA.

Cited by (0)

No later patents cite this yet.

References (0)

No backward citations on record.