Neuromedin and FN-38 Peptides for Psychotic Diseases

Abstract

Methods and compositions for treating psychiatric diseases and disorders are disclosed. The methods provided generally involve the administration of an NMX peptide, an FNX peptide, or an NMX receptor agonist, or analogs or derivatives thereof, to a subject in order to treat psychiatric diseases and disorders, and conditions associated with psychiatric diseases and disorders.

1 - 15 . (canceled) 
     
     
         16 . A method for treating a psychotic disorder in a subject in need thereof comprising administering to the subject a therapeutically effective amount of a neuromedin peptide or an FN38 peptide to treat the psychotic disorder. 
     
     
         17 . The method of  claim 16 , wherein the psychotic disorder is schizophrenia. 
     
     
         18 . The method of  claim 16 , wherein the psychotic disorder is schizophreniform disorder. 
     
     
         19 . The method of  claim 16 , wherein the psychotic disorder is schizoaffective disorder. 
     
     
         20 . The method of  claim 16 , wherein the neuromedin peptide or the FN38 peptide has at least 80% sequence identity to the peptide comprising the amino acid sequence of FLFHYSKTQKLGKSNVVEELQSPFASQSRGYFLFRPRN—NH 2  (SEQ ID NO:5). 
     
     
         21 . The method of  claim 16 , wherein the neuromedin peptide or the FN38 peptide has at least 90% sequence identity to the peptide comprising the amino acid sequence of FLFHYSKTQKLGKSNVVEELQSPFASQSRGYFLFRPRN—NH 2  (SEQ ID NO:5). 
     
     
         22 . The method of  claim 16 , wherein the neuromedin peptide or the FN38 peptide comprises the amino acid sequence of FLFHYSKTQKLGKSNVVEELQSPFASQSRGYFLFRPRN—NH 2  (SEQ ID NO:5). 
     
     
         23 . The method of  claim 16 , wherein the neuromedin peptide or the FN38 peptide comprises the amino acid sequence of: 
       
         
           
                 
                 
               
                     
                   (SEQ ID NO: 11) 
                 
                     
                   YKVNEYQGPVAPSGGFFLFRPRN-NH 2 ; 
                 
                     
                     
                 
                     
                   (SEQ ID NO: 13) 
                 
                     
                   SDEEVQVPGGVISNGYFLFRPRN-NH 2 ; 
                 
                     
                     
                 
                     
                   (SEQ ID NO: 14) 
                 
                     
                   FLFHYSKTQKLGKSNSDEEVQVPGGVISNGYFLFRPRN-NH 2 ; 
                 
                     
                     
                 
                     
                   (SEQ ID NO: 31) 
                 
                     
                   FLFHYSKTQKLGKSNVVEEFQSPFASQSRGYFLFRPRN-NH 2 ; 
                 
                     
                     
                 
                     
                   (SEQ ID NO: 51) 
                 
                     
                   FLFHYSKTQKLGKSNEELQSPFASQSRGYFLFRPRN-NH 2 ; 
                 
                     
                     
                 
                     
                   (SEQ ID NO: 52) 
                 
                     
                   FLFHYSKTQKLGKSNVVEELQSPSRGYFLFRPRN-NH 2 ; 
                 
                     
                     
                 
                     
                   (SEQ ID NO: 53) 
                 
                     
                   FLFHYSKTQKLGKSNEELQSPSRGYFLFRPRN-NH 2 ; 
                 
                     
                     
                 
                     
                   (SEQ ID NO: 54) 
                 
                     
                   YSKTQKLGKSNVVEELQSPFASQSRGYFLFRPRN-NH 2 ; 
                 
                     
                   or 
                 
                     
                     
                 
                     
                   (SEQ ID NO: 64) 
                 
                     
                   YSKTQKLGKSNEELQSPSRGYFLERPRN-NH 2 . 
                 
             
                
                
                
                
                
                
                
                
                
                
                
                
                
                
                
                
                
                
                
                
                
                
                
                
                
                
                
               
            
           
         
       
     
     
         24 . The method of  claim 16 , wherein the neuromedin peptide or the FN38 peptide comprises the amino acid sequence of SEQ ID NO:1, 2, 3, 4, 6, 7, 8, 9, 10, 12, 15, 16, or 17. 
     
     
         25 . The method of  claim 16 , wherein the neuromedin peptide or the FN38 peptide comprises the amino acid sequence of any one of SEQ ID NOs:32-50, 55-63, and 65-76. 
     
     
         26 . The method of claim  1 . 6 , further comprising administering to the subject a therapeutically effective amount of a tricyclic antidepressant, a monoamine oxidase inhibitor, a selective serotonin reuptake inhibitor, a serotonin and noradrenaline reuptake inhibitor, or a second generation antipsychotic. 
     
     
         27 . The method of  claim 16 , further comprising administering to the subject a therapeutically effective amount of a second generation antipsychotic. 
     
     
         28 . A method for treating an anxiety disorder in a subject in need thereof comprising administering to the subject a therapeutically effective amount of a neuromedin peptide or an FN38 peptide to treat the anxiety disorder. 
     
     
         29 . The method of  claim 28 , wherein the anxiety disorder is a panic disorder, a specific phobia, a social phobia, an obsessive-compulsive disorder, a posttraumatic stress disorder, an acute stress disorder, or a generalized anxiety disorder. 
     
     
         30 . The method of  claim 28 , wherein the anxiety disorder is an anxiety disorder due to a medical condition, a substance-induced anxiety disorder, or an anxiety disorder not otherwise specified. 
     
     
         31 . The method of  claim 28 , wherein the neuromedin peptide or the FN38 peptide has at least 80% sequence identity to the peptide comprising the amino acid sequence of FLFHYSKTQKLGKSNVVEELQSPFASQSRGYFLFRPRN—NH 2  (SEQ ID NO:5). 
     
     
         32 . The method of  claim 28 , wherein the neuromedin peptide or the FN38 peptide comprises the amino acid sequence of FLFHYSKTQKLGKSNVVEELQSPFASQSRGYFLFRPRN—NH 2  (SEQ ID NO:5). 
     
     
         33 . The method of  claim 28 , wherein the neuromedin peptide or the FN38 peptide comprises the amino acid sequence of: 
       
         
           
                 
                 
               
                     
                   (SEQ ID NO: 11) 
                 
                     
                   YKVNEYQGPVAPSGGFFLFRPRN-NH 2 ; 
                 
                     
                     
                 
                     
                   (SEQ ID NO: 13) 
                 
                     
                   SDEEVQVPGGVISNGYFLFRPRN-NH 2 ; 
                 
                     
                     
                 
                     
                   (SEQ ID NO: 14) 
                 
                     
                   FLFHYSKTQKLGKSNSDEEVQVPGGVISNGYFLFRPRN-NH 2 ; 
                 
                     
                     
                 
                     
                   (SEQ ID NO: 31) 
                 
                     
                   FLFHYSKTQKLGKSNVVEEFQSPFASQSRGYFLFRPRN-NH 2 ; 
                 
                     
                     
                 
                     
                   (SEQ ID NO: 51) 
                 
                     
                   FLFHYSKTQKLGKSNEELQSPFASQSRGYFLFRPRN-NH 2 ; 
                 
                     
                     
                 
                     
                   (SEQ ID NO: 52) 
                 
                     
                   FLFHYSKTQKLGKSNVVEELQSPSRGYFLFRPRN-NH 2 ; 
                 
                     
                     
                 
                     
                   (SEQ ID NO: 53) 
                 
                     
                   FLFHYSKTQKLGKSNEELQSPSRGYFLFRPRN-NH 2 ; 
                 
                     
                     
                 
                     
                   (SEQ ID NO: 54) 
                 
                     
                   YSKTQKLGKSNVVEELQSPFASQSRGYFLFRPRN-NH 2 ; 
                 
                     
                   or 
                 
                     
                     
                 
                     
                   (SEQ ID NO: 64) 
                 
                     
                   YSKTQKLGKSNEELQSPSRGYFLFRPRN-NH 2 . 
                 
             
                
                
                
                
                
                
                
                
                
                
                
                
                
                
                
                
                
                
                
                
                
                
                
                
                
                
                
               
            
           
         
       
     
     
         34 . The method of  claim 28 , wherein the neuron neuromedin peptide or the FN38 peptide comprises the amino acid sequence of any one of SEQ ID NOs:1-4, 6-10, 12, 15-17, 32-50, 55-63, and 65-76.