Dna encoding ring zinc-finger protein and the use of the dna in vectors and bacteria and in plants

Abstract

The present inventions relate to compositions and methods for providing stress tolerant transgenic plants comprising a RING domain zinc-finger motif transcription factor protein. More particularly, the invention relates to compositions and methods comprising a RING-H2 domain transcription factor protein for providing drought and salt tolerant plants, in particular comprising a recombinant XERICO gene and protein.

1 . (canceled) 
     
     
         2 . An expression vector construct comprising a nucleic acid encoding a polypeptide that has greater than 95% amino acid sequence identity to any of SEQ ID NOs: 117, or 146, wherein said nucleic acid sequence is operably linked to a heterologous promoter. 
     
     
         3 . The expression vector construct of  claim 2 , wherein said nucleic acid encodes a low complexity region with a sequence selected from the group consisting of SEQ ID NOs:456-476 and 477. 
     
     
         4 . The expression vector construct of  claim 2 , wherein said nucleic acid encodes a transmembrane domain with a sequence selected from the group consisting of SEQ ID NOs:478-491 and 492. 
     
     
         5 . The expression vector construct of  claim 2 , wherein the polypeptide that has greater than 95% amino acid sequence identity to SEQ ID NO:117, has a ring-H2 zinc finger domain with 100% sequence identity to SEQ ID NO:115. 
     
     
         6 . The expression vector construct of  claim 2 , wherein the polypeptide that has greater than 95% amino acid sequence identity to SEQ ID NO:117, has a conserved underlined sequence shown below: 
       
         
           
                 
               
                   (SEQ ID NO: 117) 
                 
                   MGISSMPAPEDSLL GFVLYNTAASVAILAGLV RAALLFLGLAAAAEDEEP 
                 
                     
                 
                   RQQAEAVTVTAVGPSLADRERSRFRPSRYGRRRGGDCRVCLVRFETESVV 
                 
                     
                 
                   QRLPCGHLFHRACLETWIDYDHATCPLCRHRLLPPAAAADEVAPDCLISA 
                 
                     
                 
                   LGIESRRSTLHLAAAVSLYRFFFSFPFCSGEREDRTEIEGRKWWQQSCSP 
                 
                     
                 
                   FVSKKKNYILYTDLSKTQNCLWACAGVDAKTTILL. 
                 
             
                
                
                
                
                
                
                
                
                
                
               
            
           
         
       
     
     
         7 . The expression vector construct of  claim 2 , wherein the polypeptide that has greater than 95% amino acid sequence identity to SEQ ID NO:146, and a ring-H2 zinc finger domain with 100% sequence identity to SEQ ID NO:147. 
     
     
         8 . The expression vector construct of  claim 2 , wherein said nucleic acid is operably linked to a terminator. 
     
     
         9 . A transgenic plant comprising a heterologous nucleic acid encoding a polypeptide that has greater than 95% amino acid sequence identity to any of SEQ ID NOs: 117, or 146, wherein said nucleic acid is operably linked to a promoter. 
     
     
         10 . The transgenic plant of clairrl 9, wherein said nucleic acid encodes a low complexity region with a sequence selected from the group consisting of SEQ ID NOs:456-476 and 477. 
     
     
         11 . The transgenic plant of  claim 9 , wherein said nucleic acid encodes a transmembrane domain with a sequence selected from the group consisting of SEQ ID NOs:478-491 and 492. 
     
     
         12 . The transgenic plant of  claim 9 , wherein the polypeptide that has greater than 95% amino acid sequence identity to SEQ ID NO:117, has a ring-H2 zinc finger domain with 100% sequence identity to SEQ ID NO:115. 
     
     
         13 . The transgenic plant of  claim 9 , wherein the polypeptide that has greater than 95% amino acid sequence identity to SEQ ID NO:117, has a conserved underlined sequence shown below: 
       
         
           
                 
               
                   (SEQ ID NO: 117) 
                 
                   MGISSMPAPEDSLL GFVLYNTAASVAILAGLV RAALLFLGLAAAAEDEEP 
                 
                     
                 
                   RQQAEAVTVTAVGPSLADIURSKFRPSRYGRRRGGDCRVCLVRFETESVV 
                 
                     
                 
                   QRLPCGHLFHRACLETWIDYDHATCPLCRHRLLPPAAAADEVAPDCLISA 
                 
                     
                 
                   LGIESRRSTLHLAAAVSLYRFFFSFPFCSGEREDWTEIEGRKWWQQSCSP 
                 
                     
                 
                   FVSKKKNYILYTDLSKTQNCLWACAGVDAKTTILL. 
                 
             
                
                
                
                
                
                
                
                
                
                
               
            
           
         
       
     
     
         14 . The transgenic plant of  claim 9 , wherein the polypeptide hat has greater than 95% amino acid sequence identity to any of SEQ ID NO:146, and a ring-finger domain with 100% sequence identity to SEQ ID NO:147. 
     
     
         15 . The transgenic plant of  claim 9 , wherein said nucleic acid is operably linked to a terminator. 
     
     
         16 . A transgenic seed comprising a heterologous nucleic acid encoding a polypeptide that has greater than 95% amino acid sequence identity to any of SEQ ID NOs: 117, or 146, wherein said nucleic acid is operably linked to a promoter. 
     
     
         17 . The transgenic seed of  claim 16 , wherein said nucleic acid encodes a low complexity region with a sequence selected from the group consisting of SEQ ID NOs:456-476 and 477. 
     
     
         18 . The transgenic seed of  claim 16 , wherein said nucleic acid encodes a transmembrane domain with a sequence selected from the group consisting of SEQ ID NOs:478-491 and 492. 
     
     
         19 . The transgenic ed of  claim 16 , wherein the polypeptide that has greater than 95% amino acid sequence identity to SEQ ID NO:117, has a ring-H2 zinc finger domain with 100% sequence identity to SEQ ID NO:115. 
     
     
         20 . The transgenic seed of  claim 16 , wherein the polypeptide that has greater than 95% amino acid sequence identity to SEQ ID NO:117, has a conserved underlined sequence shown below: 
       
         
           
                 
               
                   (SEQ ID NO: 117) 
                 
                   MGISSMPAPEDSLL GFVLYNTAASVAILAGLV RAALLFLGLAAAAEDEEP 
                 
                     
                 
                   RQQAEAVTVTAVGPSLADRFRSRFRPSRYGRRRGGDCRVCLVRFETESVV 
                 
                     
                 
                   QRLPCGHLFHRACLETWIDYDHATCPLCRHRLLPPAAAADEVAPDCLISA 
                 
                     
                 
                   LGIESRRSTLHLAAAVSLYRFFFSFPFCSGEREDRIEIEGRKWWQQSCSP 
                 
                     
                 
                   FVSKKKNYILYTDLSKTQNCLWACAGVDAKTTILL. 
                 
             
                
                
                
                
                
                
                
                
                
                
               
            
           
         
       
     
     
         21 . The transgenic plant of  claim 16 , wherein the polypeptide that has greater than 95% amino acid sequence identity to any of SEQ ID NO:146, and a ring-H2 zinc finger domain with 100% sequence identity to SEQ ID NO:147. 
     
     
         22 . transgenic plant of  claim 16 , wherein said nucleic acid is operably linked to a terminator. 
     
     
         23 . A method for generating a transgenic plant, comprising
 a) providing,
 i) an expression vector comprising a heterologous nucleic acid encoding a polypeptide that has greater than 95% ammo acid sequence identity to any of SEQ ID NOs: 117, or 146, wherein said nucleic acid is operably linked to a promoter, and 
 ii) a plant tissue, and 
   b) transfecting said plant tissue with said vector to produce a transgenic plant.   
     
     
         24 . The method of  claim 23 , wherein transgenic plant is exposed to abiotic stress. 
     
     
         25 . The method of  claim 23 , further comprising breeding said transgenic plant to produce a transgenic progeny plant. 
     
     
         26 . transgenic plant produced by the method of  claim 23 . 
     
     
         27 . A plant part of a transgenic plant comprising a heterologous nucleic acid encoding a polypeptide that has greater than 95% amino acid sequence identity to any of SEQ ID NOs: 117, or 146, wherein said nucleic acid is operably linked to a promoter.