US2019177435A1PendingUtilityA1
Compositions and methods for treatment and detection of cancers
Est. expiryJan 16, 2034(~7.5 yrs left)· nominal 20-yr term from priority
G01N 2405/10C07K 2317/24G01N 2800/52C07K 2317/21C07K 16/3069C07K 16/18C07K 16/3053C07K 16/3015G01N 2400/00C07K 16/3046C07K 2317/565C07K 2317/92A61K 2039/505C07K 16/3038C07K 2317/622C07K 2317/52C07K 2317/734C07K 16/3023A61P 35/00C07K 16/44C07K 16/30C07K 2317/567C07K 16/303G01N 33/57557G01N 33/5759G01N 33/5758G01N 33/57407G01N 33/57484G01N 33/57492
61
PatentIndex Score
0
Cited by
0
References
0
Claims
Abstract
Pharmaceutical composition comprising antibodies or antigen binding fragments thereof that bind to globo H, SSEA3, and SSEA-4 are disclosed herein, as well as methods of use thereof. Methods of use include, without limitation, cancer therapies and diagnostics. The antibodies of the disclosure can bind to certain cancer cell surfaces. Exemplary targets of the antibodies disclosed herein can include carcinomas, such as those in brain, skin, bone, lungs, breast, esophagus, stomach, liver, bile duct, pancreas, colon, kidney, cervical, ovarian, and/or prostate cancer.
Claims
exact text as granted — not AI-modified1 . An isolated humanized monoclonal glycoantibody or antigen-binding fragment thereof that specifically binds to Neu5Acα2→3Galβ1→3GalNAcβ1→3Galα1→4Galβ1→4Glcβ1.
2 . (canceled)
3 . The isolated glycoantibody or antigen-binding fragment thereof of claim 1 , wherein the antibody is an IgG or IgM.
4 . (canceled)
5 . (canceled)
6 . (canceled)
7 . (canceled)
8 . The isolated antibody or antigen-binding fragment thereof of claim 1 , wherein the antigen binding fragment is a Fab fragment, a F(ab′)2 fragment, or a single-chain Fv fragment.
9 . The isolated antibody or antigen-binding fragment thereof of claim 1 , wherein the antibody comprised VH having SEQ ID NO: 147 or SEQ ID No:137 and VL having SEQ ID No: 148 or SEQ ID No:138.
10 . The isolated antibody, or antigen-binding fragment thereof of claim 1 , comprising wherein the antibody, or antigen-binding fragment thereof comprises an H-CDR1, H-CDR2, and H-CDR3 selected from (i)-(iii):
(i) H-CDR1 selected from SEQ ID NO:152 (GFSLTSYG); (ii) H-CDR2 selected from SEQ ID NO: 153 (IWGEGST); (iii) H-CDR3 selected from SEQ ID NO:154 (AMTGTAY), respectively; and wherein the antibody, or antigen-binding fragment thereof comprises an L-CDR1, L-CDR2 and L-CDR3 selected from (iv)-(vi): (iv) L-CDR1 selected from SEQ ID NO: 149 (SSVSY); (v) L-CDR2 selected from SEQ ID NO:150 (DTS); and (vi) L-CDR3 selected from SEQ ID NO: 151(HQWSSSPHT), respectively.
11 . The isolated antibody or antigen-binding fragment thereof of claim 9 wherein the antibody or the antigen binding fragment thereof comprises an H-FR1, H-FR2, H-FR3, and HFR4 selected from (i)-(iv):
(i) H-FR1 selected from SEQ ID NO:159 (QVQLKESGPGLVAPSQSLSITCTVS);
(ii) H-FR2 selected from SEQ ID NO:160 (VSWIRQPPGKGLEWIGV);
(iii) H-FR3 selected from SEQ ID NO:161 (NYHSVLISRLTISKDNSKSQVFLKLNSLQTDDTATYYC);
(iv) H-FR4 selected from SEQ ID NO:162 (WGQGTLVTVSS); respectively;
and wherein the antibody, or antigen-binding fragment thereof comprises an L-FR1, L-FR2, L-FR3 and L-FR4 selected from (v)-(viii):
(v) L-FR1 selected from SEQ ID NO: 155 (QIVLTQSPAIMSASPGEKVTMTCSAS);
(vi) L-FR2 selected from SEQ ID NO:156 (MHWYQQKSGTSPKRWIY);
(vii) L-FR3 selected from SEQ ID NO: 157 (KLSSGVPGRFSGSGSGTSYSLTISRLEAEDAATYYC);
(viii) L-FR4 selected from SEQ ID NO: 158 (FGGGTKVEIKR); respectively.
12 . A method of treating cancer in a subject in need thereof, wherein the method comprises administering to the subject an effective amount of the isolated antibody of claim 1 and a pharmaceutically acceptable carrier or a combination thereof.
13 . The method of claim 12 , wherein the cancer is selected from the group consisting of brain cancer, lung cancer, breast cancer, oral cancer, esophageal cancer, stomach cancer, liver cancer, bile duct cancer, pancreatic cancer, colon cancer, kidney cancer, cervical cancer, ovarian cancer and prostate cancer.
14 . A method for detecting cancer in a subject, comprising:
(a) applying one or more monoclonal antibodies that detect expression of a panel of markers consisting of GM3, GM2, GM1, GD1, GD1a, GD3, GD2, GT1b, A2B5, LeX, sLeX, LeY, SSEA-3, SSEA-4, sialyl SSEA-4, Globo H, Gb4, TF, Tn, sTn, CD44, CD24, CD45, CD90, CD133/1 and CD133/2 to a cell or tissue sample obtained from the subject; (b) assaying the binding of the one or more monoclonal antibodies to the cell or the tissue sample; and (c) comparing the binding with a normal control to determine the presence of the cancer in the subject.
15 . A pharmaceutical composition comprising the antibody or antigen binding fragment thereof according to claim 1 .
16 . A method of treating cancer in a subject in need thereof, wherein the method comprises administering to the subject a therapeutically effective amount of the immunogenic pharmaceutical composition of claim 15 .
17 . The method of claim 16 , wherein a cell of the cancer expresses at least one of Globo H, SSEA3 and/or SSEA4 antigen on the surface of the cell.
18 . The method of claim 17 , wherein a cell of the cancer expresses SSEA4 antigen on the surface of the cell.
19 . The method of claim 17 , wherein a cell of the cancer expresses Globo H, SSEA3 and SSEA4 antigen simultaneously on the surface of the cell.
20 . The method of claim 17 , wherein the cancer is selected from the group consisting of brain cancer, lung cancer, breast cancer, oral cancer, esophageal cancer, stomach cancer, liver cancer, bile duct cancer, pancreatic cancer, colon cancer, kidney cancer, bone cancer (osteosarcoma), skin cancer, cervical cancer, ovarian cancer, and prostate cancer.
21 . The isolated antibody or an antigen binding fragment thereof of claim 1 , wherein the antibody comprises a N-glycan attached to the Asn-297 of the Fc region wherein the N-glycan consists of the structure of Sia 2 (α2-6)Gal 2 GlcNAc 2 Man 3 GlNAc 2 .
22 . An isolated antibody or an antigen binding fragment thereof, wherein the antibody comprises a N-glycan attached to the Asn-297 of the Fc region of said antibody wherein the N-glycan consists of the structure of Sia 2 (α2-6)Gal 2 GlcNAc 2 Man 3 GlcNAc 2 and wherein the antibody specifically binds to at least one antigen associated with cancers selected from the group consisting of Globo-H, SSEA-3, and SSEA-4.
23 . The isolated antibody of claim 21 or an antigen binding fragment thereof, wherein the antibody is an anti-SSEA4 specific glycoantibody.
24 . The isolated antibody of claim 23 or an antigen binding fragment thereof, wherein the antibody is an anti-SSEA4 specific glycoantibody with cross reactivity to Globo-H and/or SSEA3.
25 . (canceled)Join the waitlist — get patent alerts
Track US2019177435A1 — get alerts on status changes and closely related new filings.
We store only your email — no account needed. See our privacy policy.