US2019185579A1PendingUtilityA1
Humanized anti-factor d antibodies and uses thereof
Est. expiryApr 28, 2028(~1.8 yrs left)· nominal 20-yr term from priority
A61P 37/00A61P 37/06A61P 37/02A61P 27/00A61P 27/02A61P 25/00A61P 25/28A61P 29/00A61P 19/02A61P 21/04C07K 2317/24C07K 2317/567C07K 2317/55C07K 2317/565C07K 16/18A61K 2039/505C07K 2317/14C07K 2317/92C07K 2317/76C07K 16/40C07K 2317/56A61P 9/00A61K 39/395
65
PatentIndex Score
0
Cited by
0
References
0
Claims
Abstract
The invention relates to anti-Factor D antibodies, their nucleic acid and amino acid sequences, the cells and vectors that harbor these antibodies and their production and their use in the preparation of compositions and medicaments for treatment of diseases and disorders associated with excessive or uncontrolled complement activation. These antibodies are useful for diagnostics, prophylaxis and treatment of disease.
Claims
exact text as granted — not AI-modified1 . An anti-Factor D antibody comprising light chain HVRs of a reference antibody, wherein said anti-Factor D antibody further comprises a substitution at one or more positions of said reference antibody, wherein said reference antibody comprises light chain HVR-1 comprising ITSTDIDDDMN (SEQ ID NO: 30), light chain HVR-2 comprising GGNTLRP (SEQ ID NO: 35), and light chain HVR-3 comprising LQSDSLPYT (SEQ ID NO: 38), and wherein said substitution is one or more of the following:
(a) amino acid at position 33 of the light chain is L or I; (b) amino acid at position 34 of the light chain is A or Q; (c) amino acid at position 52 of the light chain is S or A; (d) amino acid at position 104 of the light chain is V; (e) amino acid at position 1 of the heavy chain is E; (f) amino acid at position 99 of the heavy chain is A or Q; or (g) amino acid at position 100 of the heavy chain is A or Q.
2 . An anti-Factor D antibody comprising heavy chain HVRs of a reference antibody, wherein said anti-Factor D antibody further comprises a substitution at one or more positions of said reference antibody, wherein said reference antibody comprises heavy chain HVR-1 comprising GYTFTNYGMN (SEQ ID NO: 39), heavy chain HVR-2 comprising WINTYTGETTYADDFKG (SEQ ID NO: 40), and heavy chain HVR-3 comprising EGGVNN (SEQ ID NO: 41), and wherein said substitution is one or more of the following:
(a) amino acid at position 33 of the light chain is L or I; (b) amino acid at position 34 of the light chain is A or Q; (c) amino acid at position 52 of the light chain is S or A; (d) amino acid at position 104 of the light chain is V; (e) amino acid at position 1 of the heavy chain is E; (f) amino acid at position 99 of the heavy chain is A or Q; or (g) amino acid at position 100 of the heavy chain is A or Q.
3 .- 21 . (canceled)
22 . A polypeptide comprising the following amino acid sequence: X 1 VQLVQSGPELKKPGASVKVSCKASGYTFTNYGMNWVRQAPGQGLEWMGWINTYTGET TYADDFKGRFVFSLDTSVSTAYLQISSLKAEDTAVYYCEREGGVX 2 X 3 WGQGTLVTVSS (SEQ ID NO: 74), wherein X 1 is Q or E; X 2 is N, A or Q; and X 3 is N, A or Q.
23 . A polypeptide comprising the following amino acid sequence: DIQVTQSPSSLSASVGDRVTITCITSTDIDDDX 4 X 5 WYQQKPGKVPKLLISGGX 6 TLRPGVPSRF SGSGSGTDFTLTISSLQPEDVATYYCLQSDSLPYTFGQGTKX 7 EIK (SEQ ID NO: 73), wherein X 4 is M, L or I; X 5 is N, A or Q; X 6 is N, S or A; and X 7 is L or V.
24 .- 25 . (canceled)
26 . An anti-Factor D antibody comprising the polypeptide of claim 22 .
27 . An anti-Factor D antibody comprising the polypeptide of claim 23 .
28 .- 46 . (canceled)
47 . A polypeptide comprising an amino acid selected from SEQ ID NOs: 47, 61, 54, and 63.
48 .- 51 . (canceled)
52 . A polynucleotide encoding the antibody of claim 1 .
53 . (canceled)
54 . A vector comprising the polynucleotide of claim 52 .
55 . A host cell comprising the vector of claim 54 .
56 .- 57 . (canceled)
58 . A method of making an anti-Factor D antibody, wherein the method comprises (a) culturing the host cell of claim 55 under conditions suitable for expression of the polynucleotide encoding the antibody, and (b) isolating the antibody.
59 .- 63 . (canceled)
64 . A pharmaceutical formulation comprising the anti-Factor D antibody of claim 1 , and a pharmaceutically acceptable diluent, carrier or excipient.
65 . An article of manufacture comprising:
(a) the pharmaceutical formulation of claim 64 ; (b) a container; and (c) a package insert or label indicating that the compound can be used to treat a complemented-associated disorder.
66 . A kit comprising an antibody of claim 1 and instructions for administering said antibody to treat a complement-associated disorder.
67 .- 69 . (canceled)
70 . A method of treating a complement-associated disorder, comprising administering to a patient in need thereof a therapeutically effective amount of an anti-Factor D antibody of claim 1 , wherein the complement-associated disorder is selected from inflammatory disorders.
71 .- 72 . (canceled)
73 . A method of treating a complement-associated disorder, comprising administering to a patient in need thereof a therapeutically effective amount of an anti-Factor D antibody of claim 1 , wherein the complement-associated disorder is selected from ocular diseases.
74 .- 76 . (canceled)Cited by (0)
No later patents cite this yet.
References (0)
No backward citations on record.