US2019389923A1PendingUtilityA1
Interferon Analogs
Est. expiryDec 31, 2029(~3.5 yrs left)· nominal 20-yr term from priority
A61P 43/00A61P 37/00A61P 9/10A61P 7/00A61P 31/16A61P 31/12A61P 35/00A61P 29/00A61P 31/14A61P 1/16A61P 21/02A61P 1/00A61P 13/12A61P 1/04A61P 11/00A61K 38/21C07K 5/0808A61K 38/12A61K 38/217C07K 5/081C07K 5/0817A61K 38/17A61K 38/20C07K 5/0819C07K 16/22C07K 16/18C07K 7/06C07K 14/57A61K 38/19A61K 38/00A61K 38/18C07K 14/555C07K 2319/09C07K 14/435C07K 2319/74C07K 5/0815C07K 14/475
53
PatentIndex Score
0
Cited by
0
References
0
Claims
Abstract
The invention relates to the field of medicine. Among others, it relates to biologically active analogs of interferons (IFNs) which show less unwanted side-effects and to the therapeutic uses thereof. Provided is an IFN analog, wherein the moiety mediating binding to its natural receptor is at least functionally disrupted and wherein the analog comprises a signaling moiety capable of mediating intracellular IFN activity, said signaling moiety being provided at its N-terminus, optionally via a linker, with at least one targeting domain capable of binding to a cell surface receptor other than the IFN receptor.
Claims
exact text as granted — not AI-modified1 . An analog of interferon gamma (IFNγ), wherein the moiety mediating binding to its natural receptor is at least functionally disrupted and wherein the analog comprises a signaling moiety capable of mediating intracellular IFNγ activity, said signaling moiety being provided at its N-terminus, optionally via a linker, with at least one targeting domain capable of binding to a cell surface receptor other than the IFNγ receptor.
2 . The analog according to claim 1 , wherein the signaling moiety mediating intracellular activity comprises a polybasic nuclear localization signal (NLS) motif.
3 . The analog according to claim 2 , wherein the polybasic NLS motif comprises the amino acid sequence (R)K XRS(R), wherein X is any amino acid residue.
4 . The analog according to claim 1 , wherein the signaling moiety comprises a sequence selected from the group consisting of
(a) the amino acid sequence
KFEVNNPQVQRQAFNELIRWHQLLPESSLRKRKRSR;
(b) the amino acid sequence
YSVTDLNVQRKAIHELIQVMAELSPAAKTGKRKRSQ;
(c) the amino acid sequence
AKFEVNNPQIQHKAVNELIRVIHQLSPESSLRKRKRSRC;
(d) a stretch of at least 10, preferably at least 15, contiguous amino acids of the sequence under (a), (b) or (c);
(e) an amino acid sequence showing at least 70%, preferably at least 80%, more preferably at least 90% identity to (a) or (b) or (c) provided that the intracellular signaling activity is maintained;
(f) the amino acid sequence under (a) or (b) or (c) wherein at most 10, preferably at most 8, more preferably at most 5 amino acid residues are deleted, added or substituted, provided that the signaling activity, for example nuclear translocation, is maintained;
(g) the consensus sequence VxxxxVQRxAxxELIxVxxxLxPxxxxxK xRS wherein x is any amino acid residue;
(h) the consensus sequence VxxxxxQxxAxxELIxVxxxLxPxxxxxKRKRS wherein x is any amino acid residue; and
(i) the consensus sequence
Vxxx[Q/N] [F/V/I] Q[R/H] [Q/K] A[F/V/I] [N/H]ELI[R/Q]Vx[H/A] [Q/E]L[L/S]P[E/A] [S/A] [S/A] [L/K]xxKRKRS wherein x is any amino acid residue.
5 . The analog according to claim 4 , comprising a signaling moiety according to the sequence:
Xaa x Xaa 2 Xaa 3 Xaa 4 Val Xaa 5 Xaa 8 Xaa 7 Xaa 8 Xaa 9 Gin Xaa 10 Xaa 11 Ala Xaa 12 Xaa 13 Glu Leu He Xaa 14 Val Xaa 15 Xaa is Xaa 17 Leu Xaa 18 Pro Xaa 19 Xaa 20 Xaa 21 Xaa 22 Xaa 23 Lys Arg Lys Arg Ser Xaa 24 Xaa 25 , wherein Xaa 1 , Xaa 2 , Xaa 3 , Xaa 4 , Xaa 6 , Xaa 11 , Xaa 13 , Xaa 14 , Xaa 16 , Xaa 17 , Xaa 18 , Xaa 19 , Xaa 20 , Xaa 21 , Xaa 22 , Xaa 23 , Xaa 24 , and Xaa 25 is any amino acid residue; Xaa 5 is a polar, uncharged residue such as Asn or Thr; Xaa 7 is a non-polar, hydrophobic residue such as Pro or Leu; Xaa 8 is a polar, uncharged residue such as Gin or Asn; Xaa 9 is a non-polar hydrophobic residue such as Val, He or Leu; Xaa 10 is a polar, basic residue such as Arg, His or Lys; Xaa 12 is a non-polar hydrophobic residue such as Phe, Val or Ile; Xaa 15 is a non-polar hydrophobic residue such as Val, He, Met.
6 . The analog according to claim 1 , wherein the targeting domain can bind to a receptor that is specific for fibroblast and fibroblast-like cells, preferably myofibroblasts, portal fibroblasts, mesangial cells, interstitial fibroblasts, alveolar fibroblasts and/or stromal cells.
7 . The analog according to claim 1 , wherein the targeting domain can bind to a receptor for an oligosaccharide or glycoprotein, preferably the mannose 6-phosphate/insulin-like growth factor-II receptor (M6P/IGF2R), asialoglycoprotein (ASGP) receptor or the mannose receptor (CD 206).
8 . The analog according to claim 7 , wherein the targeting domain is an oligosaccharide, preferably mannose(-6-phosphate) or lactose, conjugated to a carrier molecule.
9 . The analog according to claim 1 , wherein the receptor is selected from the group consisting of the PDGF receptors, collagen type VI receptor, and cytokine receptors including TGFß receptor, TNFα receptor, Insulin growth factor receptors, VEGF receptors, chemokine receptors and IL1ß receptor.
10 . The analog according to claim 9 , wherein receptor is the PDGF receptor, preferably the PDGFß receptor.
11 . The analog according to claim 1 wherein the targeting domain comprises at least one cyclic peptide portion.
12 . The analog according to any claim 11 , wherein the targeting domain comprises at least one tandem repeat of a cyclic peptide portion, preferably identical cyclic peptide portions.
13 . The analog according to claim 11 , wherein the two cyclic peptide portions within a tandem repeat are connected via a linker of 2 to 7 amino acids.
14 . The analog according to claim 13 , wherein the linker is selected from the group consisting of (i) the sequences K(GS) m GG wherein m is 1 or 2 and (ii) the sequences of the general formula [G n D m ] wherein n+m is from 4 to 7, wherein n≥4 and M an integer between 0 and 3.
15 . The analog according to claim 1 , wherein the targeting domain comprises at least the amino acid sequence RGD, KPT, SRN, NLI and/or LID.
16 . The analog according to claim 15 , wherein the targeting domain comprises the amino acid sequence CSRNLIDC-linker-CSRNLIDCS, wherein the linker is an amino acid sequence of 3 to 7, preferably 4 or 5, amino acid residues.
17 . A conjugate comprising a compound of interest conjugated to a targeting domain, said targeting domain comprising the amino acid sequence X1SRNLIDX2-linker-X3SRNLIDX4, wherein the pair of Xi and X2 and the pair of X3 and X4 can form a bond, preferably a peptidic bond, such that a bicyclic structure is formed wherein the sequences SRNLID are each part of a ring, and wherein the linker is an amino acid sequence of 2 to 7 amino acid residues.
18 . The analog according to claim 1 further comprising at least one non-antigenic polymer.
19 . An isolated nucleic acid sequence encoding an analog according to claim 1 , wherein the analog is proteinaceous.
20 . An expression vector comprising an isolated nucleic acid sequence according to claim 19 .
21 . A host cell comprising a nucleic acid sequence according to claim 18 .
22 . A pharmaceutical composition comprising an analog according to claim 1 and a pharmaceutically acceptable carrier, adjuvant and/or excipient.
23 . An analog according to claim 1 for the therapeutic or prophylactic treatment of a disease selected from cancer, viral disease, fibrotic disease, sclerotic disease and chronic or acute inflammatory diseases.
24 . An analog according to claim 23 , for the treatment of a liver disease, preferably a chronic liver disease such as liver cirrhosis.
25 . An analog according to claim 23 , for the treatment of a viral disease, preferably a disease caused by influenza virus or respiratory syncytial virus (RSV).
26 . A method for the therapeutic or prophylactic treatment of a disease selected from cancer, viral disease, fibrotic disease, sclerotic disease and chronic or acute inflammatory diseases, comprising administering to a subject in need thereof an effective dose of an analog according to claim 1 .
27 . The method according to claim 26 , wherein the disease is selected from the group consisting of glomerulosclerosis, interstitial fibrosis, lung fibrosis, atherosclerosis, rheumatoid arthritis, Crohns disease, colitis ulcerosa, glomerulonephritis and sepsis.
28 . The method according to claim 26 , wherein said administering comprises mucosal administration.
29 . The method according to claim 26 , wherein the disease is a liver disease.
30 . The method according to claim 29 , wherein the liver disease is a chronic liver disease.
31 . The analog according to claim 3 , wherein the polybasic NLS motif comprises the amino acid sequence
(R)KRXRS(R) wherein X is R, K, S or T.Cited by (0)
No later patents cite this yet.
References (0)
No backward citations on record.