Amino acid and peptide conjugates and conjugation process

Abstract

The present invention relates to amino acid and peptide conjugates, methods for making amino acid and peptide conjugates, conjugates produced by the methods, pharmaceutical compositions comprising the conjugates, methods of eliciting immune responses in a subject and methods of vaccinating a subject, uses of the conjugates for the same, and uses of the conjugates in the manufacture of medicaments for the same.

1 - 93 . (canceled) 
     
     
         94 : A compound of the formula (V): 
       
         
           
           
               
               
           
         
       
       wherein
 m is an integer from 0 to 4; 
 n is 1 or 2; 
 R1 and R2 at each instance of m are each independently hydrogen, C1-6alkyl, or C3-6cycloalkyl; 
 R3, R4, R5, R8, and R9 are each independently hydrogen, C1-6alkyl, or C3-6cycloalkyl; or R9 is an amino protecting group, L3-C(O), or A2; 
 R6 and R7 at each instance of n are each independently hydrogen, C1-6alkyl, or C3-6cycloalkyl, 
 L1 is C5-21alkyl or C4-20heteroalkyl; 
 L3 is C1-6alkyl or C3-6cycloalkyl; 
 A1 and A2 are each independently an amino acid or a peptide; or A1 is OH or OP1, wherein P1 is a carboxyl protecting group; 
 wherein any alkyl, cycloalkyl or heteroalkyl present in any of R1, R2, R4, R5, R6, R7, R8, R9, L1, and L3 and any cycloalkyl in R3 is optionally substituted with one or more substituents independently selected from the group consisting of halo, CN, NO 2 , OH, NH 2 , NH(C1-6alkyl), N(C1-6alkyl) (C1-6alkyl), C1-6haloalkyl, C1-6haloalkoxy, C(O)NH 2 , C(O)NH(C1-6alkyl), C(O)N(C1-6alkyl) (C1-6alkyl), SO 2 (C1-6alkyl), O(C1-6alkyl), S(C1-6alkyl), S(O) (C1-6alkyl), C(O) (C1-6alkyl), and C1-6aliphatic, 
 wherein 1) A1 is a peptide comprising an epitope or 2) R9 is A2 and is a peptide comprising an epitope; and 
 wherein the peptide comprising the epitope comprises at least 8 amino acids, 
 
       or a pharmaceutically acceptable salt or solvate thereof. 
     
     
         95 : The compound of  claim 94 , wherein R9 is independently hydrogen, C1-6alkyl, or C3-6cycloalkyl; or R9 is L3-C(O) or A2; and
 A1 and A2 are each independently a peptide; or A1 is OH;
 provided that:
 at least one of A1 and A2 comprises an epitope; and 
 when R9 is not A2, A1 is a peptide. 
 
   
     
     
         96 : The compound of  claim 94 , wherein L1 is C5-21alkyl. 
     
     
         97 : The compound of  claim 94 , wherein m is an integer from 0 to 2. 
     
     
         98 : The compound of  claim 94 , wherein R1 and R2 at each instance of m are each independently hydrogen. 
     
     
         99 : The compound of  claim 94 , wherein R3 is hydrogen. 
     
     
         100 : The compound of  claim 94 , wherein R4 and R5 are each hydrogen. 
     
     
         101 : The compound of  claim 94 , wherein R6 and R7 are each hydrogen. 
     
     
         102 : The compound of  claim 94 , wherein R8 is hydrogen and R9 is hydrogen, an amino protecting group, L3-C(O), or A2. 
     
     
         103 : The compound of  claim 94 , wherein L3 is Me. 
     
     
         104 : The compound of  claim 94 , wherein the peptide comprises a peptide epitope. 
     
     
         105 : The compound of  claim 94 , wherein A1 is serine or a peptide comprising serine as the first N-terminal amino acid residue. 
     
     
         106 : The compound of  claim 94 , wherein A1 and/or A2 is a peptide comprising a solubilising group comprising an amino acid sequence comprising two or more hydrophilic amino acid residues in the peptide chain. 
     
     
         107 : The compound of  claim 94  wherein the peptide comprises, consists essentially of, or consists of an amino acid sequence selected from the group consisting of
 a. 8 or more contiguous amino acid residues from the sequence Xaa 1 Xaa 2 Xaa 3 Xaa 4 GARGPESRLLEFYLAMPFATPMEAELARRSLAQDAPPL [SEQ ID NO:1], wherein Xaa 1  is absent or is S, Xaa 2  is absent or is a hydrophilic amino acid, Xaa 3  is absent or is a hydrophilic amino acid, and Xaa 4  is absent or is one or more hydrophilic amino acids, 
 b. 8 or more contiguous amino acid residues from the sequence Xaa 1 Xaa 2 Xaa 3 GARGPESRLLEFYLAMPFATPMEAELARRSLAQDAPPL [SEQ ID NO:2], wherein Xaa 1  is absent or is S, Xaa 2  is absent or is a hydrophilic amino acid, and Xaa 3  is absent or is from one to ten hydrophilic amino acids, 
 c. 8 or more contiguous amino acid residues from the sequence Xaa 1 Xaa 2 GARGPESRLLEFYLAMPFATPMEAELARRSLAQDAPPL [SEQ ID NO:3], wherein Xaa 1  is absent or is S, and Xaa 2  is absent or is from one to four hydrophilic amino acids, 
 d. 8 or more contiguous amino acid residues from the sequence SKKKKGARGPESRLLEFYLAMPFATPMEAELARRSLAQDAPPL [SEQ ID NO:4], 
 e. 8 or more contiguous amino acid residues from the sequence GARGPESRLLEFYLAMPFATPMEAELARRSLAQDAPPL [SEQ ID NO:5], 
 f. 8 or more contiguous amino acid residues from the sequence LAMPFATPM [SEQ ID NO:6], 
 g. 8 or more contiguous amino acid residues from the sequence FATPMEAEL [SEQ ID NO:7], 
 h. 8 or more contiguous amino acid residues from the sequence Xaa 1 Xaa 2 Xaa 3 Xaa 4 VPGVLLKEFTVSGNILTIRLTAADHR [SEQ ID NO:8], wherein Xaa 1  is absent or is S, Xaa 2  is absent or is a hydrophilic amino acid, Xaa 3  is absent or is a hydrophilic amino acid, and Xaa 4  is absent or is one or more hydrophilic amino acids, 
 i. 8 or more contiguous amino acid residues from the sequence Xaa 1 Xaa 2 Xaa 3 VPGVLLKEFTVSGNILTIRLTAADHR [SEQ ID NO:9], wherein Xaa 1  is absent or is S, Xaa 2  is absent or is a hydrophilic amino acid, and Xaa 3  is absent or is from one to ten hydrophilic amino acids, 
 j. 8 or more contiguous amino acid residues from the sequence Xaa 1 Xaa 2 VPGVLLKEFTVSGNILTIRLTAADHR [SEQ ID NO:10], wherein Xaa 1  is absent or is S, and Xaa 2  is absent or is from one to four hydrophilic amino acids, 
 k. 8 or more contiguous amino acid residues from the sequence SKKKKVPGVLLKEFTVSGNILTIRLTAADHR [SEQ ID NO:11], 
 l. 8 or more contiguous amino acid residues from the sequence VPGVLLKEFTVSGNILTIRLTAADHR [SEQ ID NO:12], 
 m. 8 or more contiguous amino acid residues from the sequence EFTVSGNIL [SEQ ID NO:13], 
 n. 8 or more contiguous amino acid residues from the sequence Xaa 1 Xaa 2 Xaa 3 Xaa 4 LQQLSLLMWITQCFLPVFLAQPPSGQRR [SEQ ID NO:14], wherein Xaa 1  is absent or is S, Xaa 2  is absent or is a hydrophilic amino acid, Xaa 3  is absent or is a hydrophilic amino acid, and Xaa 4  is absent or is one or more hydrophilic amino acids 
 o. 8 or more contiguous amino acid residues from the sequence Xaa 1 Xaa 2 Xaa 3 LQQLSLLMWITQCFLPVFLAQPPSGQRR [SEQ ID NO:15], wherein Xaa 1  is absent or is S, Xaa 2  is absent or is a hydrophilic amino acid, and Xaa 3  is absent or is from one to ten hydrophilic amino acids, 
 p. 8 or more contiguous amino acid residues from the sequence Xaa 1 Xaa 2 LQQLSLLMWITQCFLPVFLAQPPSGQRR [SEQ ID NO:16], wherein Xaa 1  is absent or is S, and Xaa 2  is absent or is from one to four hydrophilic amino acids, 
 q. 8 or more contiguous amino acid residues from the sequence SKKKKLQQLSLLMWITQCFLPVFLAQPPSGQRR [SEQ ID NO:17], 
 r. 8 or more contiguous amino acid residues from the sequence LQQLSLLMWITQCFLPVFLAQPPSGQRR [SEQ ID NO:18], 
 s. 8 or more contiguous amino acid residues from the sequence SLLMWITQCFLPVF [SEQ ID NO:19], 
 t. 8 or more contiguous amino acid residues from the sequence SLLMWITQC [SEQ ID NO:20], 
 u. the sequence of any one of SEQ ID NOs: 1 to 20, 
 v. or any combination of two or more of (a) to (u) above. 
 
     
     
         108 : A pharmaceutical composition comprising an effective amount of a peptide conjugate of  claim 94  or a pharmaceutically acceptable salt or solvate thereof, and a pharmaceutically acceptable carrier. 
     
     
         109 : A method of vaccinating or eliciting an immune response in a subject comprising administering to the subject an effective amount of a peptide conjugate of  claim 94  or a pharmaceutically acceptable salt or solvate thereof or an effective amount of a pharmaceutical composition comprising a peptide conjugate of  claim 94  or a pharmaceutically acceptable salt or solvate thereof, and a pharmaceutically acceptable carrier. 
     
     
         110 : The compound of  claim 94 , wherein L1 is C11-C21alkyl; m is 0; R3 is hydrogen; R4 and R5 are each hydrogen; n is 1, R6, R7, and R8 are each hydrogen; R9 is hydrogen or L3-C(O), wherein L3 is methyl. 
     
     
         111 : A method for making a peptide conjugate according to  claim 94 , the method comprising reacting
 a lipid-containing conjugation partner, and   an amino acid-comprising conjugation partner   under conditions effective to conjugate the lipid-containing conjugation partner to the amino acid-comprising conjugation partner by the hydrothiolation of a carbon-carbon double bond with a thiol.