US2020369750A1PendingUtilityA1

Histamine-releasing factor (hrf), hrf-receptor and methods of modulating inflammation

Assignee: LA JOLLA INST ALLERGY & IMMUNOLOGYPriority: Mar 31, 2010Filed: Jul 16, 2019Published: Nov 26, 2020
Est. expiryMar 31, 2030(~3.6 yrs left)· nominal 20-yr term from priority
A61K 38/1709C07K 16/18G01N 2500/02A61K 2039/505C07K 14/47C07K 2317/76G01N 2800/24C07K 7/08C07K 2317/24C07K 14/52A61K 39/3955C07K 2319/00
65
PatentIndex Score
0
Cited by
0
References
0
Claims

Abstract

Methods of treating a food allergy, allergic reactions, hypersensitivity, inflammatory responses, inflammation are provided. In one method, histamine releasing factor (HRF)/translationally controlled tumor protein (TCTP) is contacted with a compound that inhibits or reduces binding of HRF/TCTP to an immunoglobulin in order to treat the food allergy, allergic reaction, hypersensitivity, inflammatory response, or inflammation. Methods of reducing or decreasing the probability, severity, frequency, duration or preventing a subject from having an acute or chronic food allergy, allergic reaction, hypersensitivity, an inflammatory response or inflammation, are also provided. In one method, histamine releasing factor (HRF)/translationally controlled tumor protein (TCTP) is contacted with a compound that inhibits or reduces binding of HRF/TCTP to an immunoglobulin in order to reduce or decrease the probability, severity, frequency, duration or prevent a subject from having an acute or chronic food allergy, allergic reaction, hypersensitivity, an inflammatory response or inflammation.

Claims

exact text as granted — not AI-modified
1 . (canceled) 
     
     
         2 . A method of treating an allergic reaction, hypersensitivity, an inflammatory response or inflammation, comprising contacting histamine releasing factor (HRF)/translationally controlled tumor protein (TCTP) with a compound that inhibits or reduces binding of HRF/TCTP to an immunoglobulin thereby treating the allergic reaction, hypersensitivity, inflammatory response or inflammation. 
     
     
         3 . (canceled) 
     
     
         4 . The method of  claim 2 , wherein the compound comprises a peptide or polypeptide. 
     
     
         5 . The method of  claim 4 , wherein the peptide or polypeptide comprises an antibody or an antibody subsequence that binds to HRF/TCTP. 
     
     
         6 . The method of  claim 5 , wherein the antibody or antibody subsequence is human or humanized. 
     
     
         7 . The method of  claim 5 , wherein the antibody or antibody subsequence is monoclonal. 
     
     
         8 . The method of  claim 5 , wherein the antibody or antibody subsequence competes for binding of an antibody set forth in Tables 2 or 3 for binding to the HRF/TCTP. 
     
     
         9 . The method of  claim 5 , wherein the antibody or antibody subsequence binds to an epitope of HRF/TCTP to which an antibody set forth in Tables 2 or 3 binds. 
     
     
         10 . (canceled) 
     
     
         11 . The method of  claim 5 , wherein the antibody or antibody subsequence has a binding affinity (Kd) for binding to HRF/TCTP within about 1-1000 of the binding affinity (Kd) of an antibody set forth in Tables 2 or 3 for binding to HRF/TCTP. 
     
     
         12 . The method of  claim 5 , wherein the antibody or subsequence isotype comprises an IgM, IgG, IgA, IgD or IgE isotype. 
     
     
         13 - 14 . (canceled) 
     
     
         15 . The method of  claim 4 , wherein the HRF/TCTP polypeptide, or a fragment of an HRF/TCTP polypeptide comprises a fusion or chimeric polypeptide. 
     
     
         16 - 19 . (canceled) 
     
     
         20 . The method of  claim 15 , wherein the fragment of HRF/TCTP polypeptide that binds to an immunoglobulin comprises or consists of MIIYRDLISHDEMFSDIYK (SEQ ID NO:1) or QETSFTKEAYKKYIKDYMKSIKGKLEEQRPERVKPFMTGAAEQIKHILANFKNYQFFI GENMNP (SEQ ID NO:2) sequence. 
     
     
         21 - 22 . (canceled) 
     
     
         23 . The method of  claim 2 , wherein the food allergy, allergic reaction, hypersensitivity, inflammatory response or inflammation is chronic or acute. 
     
     
         24 . (canceled) 
     
     
         25 . The method of  claim 2 , wherein the treatment is sufficient to decrease, reduce, inhibit, suppress, limit, control or improve the probability, severity, frequency, or duration of one or more adverse symptoms, disorders, illnesses, pathologies, diseases, or complications caused by or associated with the food allergy, allergic reaction, hypersensitivity, inflammatory response or inflammation. 
     
     
         26 - 27 . (canceled) 
     
     
         28 . The method of  claim 2 , wherein the allergic reaction is selected from: Extrinsic or intrinsic bronchial asthma; Allergic rhinitis; Onchocercal dermatitis; Atopic dermatitis; eczema; rash; allergic urticaria (e.g. hives); allergic conjunctivitis; Drug reactions; Nodules, eosinophilia, rheumatism, dermatitis, and swelling (NERDS); Eosophageal and a gastrointestinal allergy. 
     
     
         29 . The method of  claim 2 , wherein the hypersensitivity, inflammatory response or inflammation comprises a respiratory disease or disorder. 
     
     
         30 - 31 . (canceled) 
     
     
         32 . The method of  claim 29 , wherein the respiratory disease or disorder is selected from: Airway Obstruction, Apnea, Asbestosis, Atelectasis, Berylliosis, Bronchiectasis, Bronchiolitis, Bronchiolitis Obliterans Organizing Pneumonia, Bronchitis, Bronchopulmonary Dysplasia, Empyema, Pleural Empyema, Pleural Epiglottitis, Hemoptysis, Hypertension, Kartagener Syndrome, Meconium Aspiration, Pleural Effusion, Pleurisy, Pneumonia, Pneumothorax, Respiratory Distress Syndrome, Respiratory Hypersensitivity, Rhinoscleroma, Scimitar Syndrome, Severe Acute Respiratory Syndrome, Silicosis, Tracheal Stenosis, eosinophilic pleural effusions, Histiocytosis; chronic eosinophilic pneumonia; hypersensitivity pneumonitis; Allergic bronchopulmonary aspergillosis; Sarcoidosis; Idiopathic pulmonary fibrosis; pulmonary edema; pulmonary embolism; pulmonary emphysema; Pulmonary Hyperventilation; Pulmonary Alveolar Proteinosis; Chronic Obstructive Pulmonary Disease (COPD); Interstitial Lung Disease; allergic rhinoconjunctivitis; allergic conjunctivitis and Topical eosinophilia. 
     
     
         33 - 35 . (canceled) 
     
     
         36 . The method of  claim 2 , wherein the compound is administered prior to, substantially contemporaneously with or following one or more adverse symptoms, disorders, illnesses, pathologies, diseases, or complications caused by or associated with the food allergy, allergic reaction or hypersensitivity. 
     
     
         37 . The method of  claim 2 , further comprising administering a second drug. 
     
     
         38 - 39 . (canceled) 
     
     
         40 . The method of any of  claim 2 , wherein the compound is administered via ingestion, via inhalation, or topically. 
     
     
         41 . The method of any of  claim 2 , wherein the subject is administered the compound one, two, three, four or more times daily, weekly, monthly, bi-monthly, or annually. 
     
     
         42 - 71 . (canceled)

Join the waitlist — get patent alerts

Track US2020369750A1 — get alerts on status changes and closely related new filings.

We store only your email — no account needed. See our privacy policy.