Treatment for rheumatoid arthritis

Abstract

The present invention provides anti-GM-CSF antibodies for use in the treatment of rheumatoid arthritis. Anti-GM-CSF antibodies, in particular MOR103, are administered to patients suffering from rheumatoid arthritis at dosages that are beneficial in a clinical setting.

1 .- 20 . (canceled) 
     
     
         21 . A pharmaceutical composition comprising:
 (a) an anti-Granulocyte-Macrophage Colony Stimulating Factor (anti-GM-CSF) antibody;   (b) histidine;   (c) sorbitol; and   (d) Tween-80,   wherein said anti-GM-CSF antibody comprises the HCDR1 region of sequence GFTFSSYWMN (SEQ ID NO.: 2), the HCDR2 region of sequence GIENKYAGGATYYAASVKG (SEQ ID NO.: 3), the HCDR3 region of sequence GFGTDF (SEQ ID NO.: 4), the LCDR1 region of sequence SGDSIGKKYAY (SEQ ID NO.: 5), the LCDR2 region of sequence KKRPS (SEQ ID NO.: 6), and the LCDR3 region of sequence SAWGDKGM (SEQ ID NO.: 7).   
     
     
         22 . The pharmaceutical composition according to  claim 21 , wherein said anti-GM-CSF antibody comprises the variable heavy chain peptide of sequence: 
       
         
           
                 
               
                   (SEQ ID NO: 8) 
                 
                   QVQLVESGGGLVQPGGSLRLSCAASGFTFSSYWMNWVRQAPGKGLEWVSG 
                 
                     
                 
                   IENKYAGGATYYAASVKGRFTISRDNSKNTLYLQMNSLRAEDTAVYYCAR 
                 
                     
                 
                   GFGTDFWGQGTLVTVSS; 
                 
             
                
                
                
                
                
                
               
            
           
         
         and the variable light chain peptide of sequence: 
       
       
         
           
                 
               
                   (SEQ ID NO: 9) 
                 
                   DIELTQPPSVSVAPGQTARISCSGDSIGKKYAYWYQQKPGQAPVLVIYKK 
                 
                     
                 
                   RPSGIPERFSG SNSGNTATLTISGTQAEDEADYYCSAWGDKGMVFGGGT 
                 
                     
                 
                   KLTVLGQ. 
                 
             
                
                
                
                
                
                
               
            
           
         
       
     
     
         23 . The pharmaceutical composition according to  claim 21 , comprising:
 (b) 30 mM histidine;   (c) 200 mM sorbitol; and   (d) 0.02% Tween-80.   
     
     
         24 . The pharmaceutical composition according to  claim 23 , comprising 40 mg to 400 mg of the anti-GM-CSF antibody. 
     
     
         25 . The pharmaceutical composition according to  claim 23 , comprising 75 mg, 100 mg, 150 mg, 180 mg, 200 mg, 300 mg, or 400 mg of the anti-GM-CSF antibody. 
     
     
         26 . The pharmaceutical composition according to  claim 23 , comprising 75 mg of the anti-GM-CSF antibody. 
     
     
         27 . The pharmaceutical composition according to  claim 23 , comprising 100 mg of the anti-GM-CSF antibody. 
     
     
         28 . The pharmaceutical composition according to  claim 23 , comprising 150 mg of the anti-GM-CSF antibody. 
     
     
         29 . The pharmaceutical composition according to  claim 23 , comprising 180 mg of the anti-GM-CSF antibody. 
     
     
         30 . The pharmaceutical composition according to  claim 23 , wherein the composition has a pH of 6.0. 
     
     
         31 . The pharmaceutical composition according to  claim 22 , comprising:
 (b) 30 mM histidine;   (c) 200 mM sorbitol; and   (d) 0.02% Tween-80.   
     
     
         32 . The pharmaceutical composition according to  claim 31 , comprising 40 mg to 400 mg of the anti-GM-CSF antibody. 
     
     
         33 . The pharmaceutical composition according to  claim 31 , comprising 75 mg, 100 mg, 150 mg, 180 mg, 200 mg, 300 mg, or 400 mg of the anti-GM-CSF antibody. 
     
     
         34 . The pharmaceutical composition according to  claim 31 , comprising 75 mg of the anti-GM-CSF antibody. 
     
     
         35 . The pharmaceutical composition according to  claim 31 , comprising 100 mg of the anti-GM-CSF antibody. 
     
     
         36 . The pharmaceutical composition according to  claim 31 , comprising 150 mg of the anti-GM-CSF antibody. 
     
     
         37 . The pharmaceutical composition according to  claim 31 , comprising 180 mg of the anti-GM-CSF antibody. 
     
     
         38 . The pharmaceutical composition according to  claim 31 , wherein the composition has a pH of 6.0.