US2022064331A1PendingUtilityA1

Antibodies and methods of use

Assignee: GENENTECH INCPriority: Dec 23, 2013Filed: Jun 8, 2021Published: Mar 3, 2022
Est. expiryDec 23, 2033(~7.4 yrs left)· nominal 20-yr term from priority
C07K 2317/92C07K 2317/75C07K 2317/71C07K 2317/55C07K 2317/24C07K 16/2863A61P 3/10A61K 2039/505C07K 16/40C07K 2317/524C07K 2317/515A61P 9/12C07K 2317/31A61P 25/28C07K 2317/21C07K 14/71C07K 2317/567C07K 2317/56A61P 3/04C07K 2317/41A61P 15/08A61P 21/02A61P 3/00C07K 2317/33A61P 3/06C07K 2317/40C07K 2317/51C07K 2317/565A61P 43/00C07K 2317/34A61P 25/16A61P 1/16
75
PatentIndex Score
0
Cited by
0
References
0
Claims

Abstract

The presently disclosed subject matter provides antibodies that bind KLB and FGFR1, and methods of using the same. In certain embodiments, an antibody of the present disclosure includes a bispecific antibody that binds to an epitope present on FGFR1 and binds to an epitope present on KLB.

Claims

exact text as granted — not AI-modified
What is claimed is: 
     
         1 . A composition comprising:
 (a) an isolated bispecific antibody, or an antigen-binding portion thereof, that binds to beta-Klotho (KLB) and Fibroblast Growth Factor Receptor 1 (FGFR1);   (b) a nucleic acid encoding a bispecific antibody, or an antigen-binding portion thereof, that binds to beta-Klotho (KLB) and Fibroblast Growth Factor Receptor 1 (FGFR1);   (c) a host cell comprising a nucleic acid encoding a bispecific antibody, or an antigen-binding portion thereof, that binds to beta-Klotho (KLB) and Fibroblast Growth Factor Receptor 1 (FGFR1);   (d) an anti-KLB antibody, or an antigen-binding portion thereof; or   (e) a pharmaceutical formulation comprising an isolated bispecific antibody, or an antigen-binding portion thereof, that binds to beta-Klotho (KLB) and Fibroblast Growth Factor Receptor 1 (FGFR1).   
     
     
         2 . The composition of  claim 1 , wherein the bispecific antibody, or an antigen-binding portion thereof, binds to an FGFR1 epitope within a fragment of FGFR1c comprising the amino acid sequence set forth in SEQ ID NO: 143 or SEQ ID NO: 144. 
     
     
         3 . The composition of  claim 1 , wherein the bispecific antibody, or an antigen-binding portion thereof, binds to a KLB epitope within a fragment of KLB consisting of the amino acid sequence SSPTRLAVIPWGVRKLLRWVRRNYGDMDIYITAS (SEQ ID NO: 142). 
     
     
         4 . The composition of  claim 1 , wherein the bispecific antibody, or an antigen-binding portion thereof, comprises (a) a heavy chain variable region comprising the amino acid sequence of SEQ ID NO: 128 and (b) a light chain variable region comprising the amino acid sequence of SEQ ID NO: 130. 
     
     
         5 . The composition of  claim 1 , wherein the bispecific antibody, or an antigen-binding portion thereof, comprises (a) a heavy chain comprising the amino acid sequence of SEQ ID NO: 132 and (b) a light chain comprising the amino acid sequence of SEQ ID NO: 134. 
     
     
         6 . The composition of  claim 1 , wherein the bispecific antibody, or an antigen-binding portion thereof, comprises:
 (a) a heavy chain variable region CDR1 comprising an amino acid sequence selected from the group consisting of SEQ ID NOs: 1-15, and conservative substitutions thereof;   (b) a heavy chain variable region CDR2 domain comprising an amino acid sequence selected from the group consisting of SEQ ID NOs: 16-31, and conservative substitutions thereof;   (c) a heavy chain variable region CDR3 domain comprising an amino acid sequence selected from the group consisting of SEQ ID NOs: 32-47, and conservative substitutions thereof;   (d) a light chain variable region CDR1 domain comprising an amino acid sequence selected from the group consisting of SEQ ID NOs: 48-62, and conservative substitutions thereof;   (e) a light chain variable region CDR2 domain comprising an amino acid sequence selected from the group consisting of SEQ ID NOs: 63-78, and conservative substitutions thereof; and   (f) a light chain variable region CDR3 domain comprising an amino acid sequence selected from the group consisting of SEQ ID NOs: 79-93, and conservative substitutions thereof.   
     
     
         7 . The composition of  claim 1 , wherein the bispecific antibody, or an antigen-binding portion thereof, comprises (a) HVR-H1 comprising the amino acid sequence of SEQ ID NO: 136, (b) HVR-H2 comprising the amino acid sequence of SEQ ID NO: 137, (c) HVR-H3 comprising the amino acid sequence of SEQ ID NO: 138, (d) HVR-L1 comprising the amino acid sequence of SEQ ID NO: 139, (e) HVR-L2 comprising the amino acid sequence of SEQ ID NO: 140, and (f) HVR-L3 comprising the amino acid sequence of SEQ ID NO: 141. 
     
     
         8 . The composition of  claim 1 , wherein the anti-KLB antibody, or an antigen-binding portion thereof, comprises:
 (a) a heavy chain variable region CDR1 comprising an amino acid sequence selected from the group consisting of SEQ ID NOs: 1-15, and conservative substitutions thereof;   (b) a heavy chain variable region CDR2 domain comprising an amino acid sequence selected from the group consisting of SEQ ID NOs: 16-31, and conservative substitutions thereof; and   (c) a heavy chain variable region CDR3 domain comprising an amino acid sequence selected from the group consisting of SEQ ID NOs: 32-47, and conservative substitutions thereof.   
     
     
         9 . The composition of  claim 1 , wherein the anti-KLB antibody, or an antigen-binding portion thereof, comprises:
 (a) a light chain variable region CDR1 domain comprising an amino acid sequence selected from the group consisting of SEQ ID NOs: 48-62, and conservative substitutions thereof;   (b) a light chain variable region CDR2 domain comprising an amino acid sequence selected from the group consisting of SEQ ID NOs: 63-78, and conservative substitutions thereof; and   (c) a light chain variable region CDR3 domain comprising an amino acid sequence selected from the group consisting of SEQ ID NOs: 79-93, and conservative substitutions thereof.   
     
     
         10 . The composition of  claim 1 , wherein the pharmaceutical formulation further comprises a pharmaceutically acceptable carrier. 
     
     
         11 . The composition of  claim 1 , wherein the nucleic acid encodes a bispecific antibody, or an antigen-binding portion thereof, that binds to beta-Klotho (KLB) and Fibroblast Growth Factor Receptor 1 (FGFR1). 
     
     
         12 . The composition of  claim 1 , wherein the host cell comprises a nucleic acid encoding a bispecific antibody, or an antigen-binding portion thereof, that binds to beta-Klotho (KLB) and Fibroblast Growth Factor Receptor 1 (FGFR1). 
     
     
         13 . A method of treating an individual having a disease selected from the group consisting of polycystic ovary syndrome (PCOS), metabolic syndrome (MetS), obesity, non-alcoholic steatohepatitis (NASH), non-alcoholic fatty liver disease (NAFLD), hyperlipidemia, hypertension, type 2 diabetes, non-type 2 diabetes, type 1 diabetes, latent autoimmune diabetes (LAD), maturity onset diabetes of the young (MODY), and aging and related diseases such as Alzheimer's disease, Parkinson's disease and ALS, Bardet-Biedl syndrome, Prader-Willi syndrome, Alstrom syndrome, Cohen syndrome, Albright's hereditary osteodystrophy (pseudohypoparathyroidism), Carpenter syndrome, MOMO syndrome, Rubinstein-Taybi syndrome, fragile X syndrome and Börjeson-Forssman-Lehman syndrome, comprising administering to the individual an effective amount of one or more antibodies, wherein the one or more antibodies is selected from the group consisting of an isolated bispecific antibody, or an antigen-binding portion thereof, that binds to beta-Klotho (KLB) and Fibroblast Growth Factor Receptor 1 (FGFR1), and an anti-KLB antibody, or an antigen-binding portion thereof. 
     
     
         14 . The method of  claim 13 , wherein the one or more antibodies reduces blood glucose levels in vivo. 
     
     
         15 . The method of  claim 13 , wherein the bispecific antibody, or an antigen-binding portion thereof, to a KLB epitope within a fragment of KLB consisting of the amino acid sequence SSPTRLAVIPWGVRKLLRWVRRNYGDMDIYITAS (SEQ ID NO: 142). 
     
     
         16 . The method of  claim 13 , wherein the bispecific antibody, or an antigen-binding portion thereof, comprises:
 (a) a heavy chain variable region CDR1 comprising an amino acid sequence selected from the group consisting of SEQ ID NOs: 1-15, and conservative substitutions thereof;   (b) a heavy chain variable region CDR2 domain comprising an amino acid sequence selected from the group consisting of SEQ ID NOs: 16-31, and conservative substitutions thereof;   (c) a heavy chain variable region CDR3 domain comprising an amino acid sequence selected from the group consisting of SEQ ID NOs: 32-47, and conservative substitutions thereof;   (d) a light chain variable region CDR1 domain comprising an amino acid sequence selected from the group consisting of SEQ ID NOs: 48-62, and conservative substitutions thereof;   (e) a light chain variable region CDR2 domain comprising an amino acid sequence selected from the group consisting of SEQ ID NOs: 63-78, and conservative substitutions thereof; and   (f) a light chain variable region CDR3 domain comprising an amino acid sequence selected from the group consisting of SEQ ID NOs: 79-93, and conservative substitutions thereof.   
     
     
         17 . The composition of  claim 13 , wherein the anti-KLB antibody, or an antigen-binding portion thereof, comprises:
 (a) a heavy chain variable region CDR1 comprising an amino acid sequence selected from the group consisting of SEQ ID NOs: 1-15, and conservative substitutions thereof;   (b) a heavy chain variable region CDR2 domain comprising an amino acid sequence selected from the group consisting of SEQ ID NOs: 16-31, and conservative substitutions thereof; and   (c) a heavy chain variable region CDR3 domain comprising an amino acid sequence selected from the group consisting of SEQ ID NOs: 32-47, and conservative substitutions thereof.   
     
     
         18 . The method of  claim 13 , wherein the anti-KLB antibody, or an antigen-binding portion thereof, comprises:
 (a) a light chain variable region CDR1 domain comprising an amino acid sequence selected from the group consisting of SEQ ID NOs: 48-62, and conservative substitutions thereof;   (b) a light chain variable region CDR2 domain comprising an amino acid sequence selected from the group consisting of SEQ ID NOs: 63-78, and conservative substitutions thereof; and   (c) a light chain variable region CDR3 domain comprising an amino acid sequence selected from the group consisting of SEQ ID NOs: 79-93, and conservative substitutions thereof.   
     
     
         19 . A method of producing an antibody comprising culturing a cell host cell that comprises a nucleic acid encoding a bispecific antibody, or an antigen-binding portion thereof, that binds to beta-Klotho (KLB) and Fibroblast Growth Factor Receptor 1 (FGFR1). 
     
     
         20 . The method of  claim 19 , wherein the bispecific antibody, or an antigen-binding portion thereof, comprises
 (a) a first antibody, or antigen binding portion thereof, comprising a heavy chain variable region and a light chain variable region, wherein the heavy chain variable region comprises amino acids having a sequence that is at least 95% identical to the sequence set forth in SEQ ID NO: 128, and the light chain variable region comprises amino acids having a sequence that is at least 95% identical to the sequence set forth in SEQ ID NO: 130; and   (b) a second antibody, or antigen binding portion thereof, comprising a heavy chain variable region and a light chain variable region, wherein the heavy chain variable region comprises amino acids having a sequence that is at least 95% identical to the sequence set forth in SEQ ID NO: 132, and the light chain variable region comprises amino acids having a sequence that is at least 95% identical to the sequence set forth in SEQ ID NO: 134.

Join the waitlist — get patent alerts

Track US2022064331A1 — get alerts on status changes and closely related new filings.

We store only your email — no account needed. See our privacy policy.