US2022267471A1PendingUtilityA1

Human Anti-SOD1 Antibodies

Assignee: NEURIMMUNE HOLDING AGPriority: Dec 17, 2010Filed: May 6, 2022Published: Aug 25, 2022
Est. expiryDec 17, 2030(~4.4 yrs left)· nominal 20-yr term from priority
G01N 2333/90283C12Y 115/01001C07K 2317/21C07K 2317/24G01N 2800/28G01N 33/573A61K 39/0005A61P 43/00A61K 39/3955G01N 2800/285A61K 47/6871A61K 51/10G01N 33/577C07K 2317/565C12N 9/0089G01N 33/6893A61K 45/06C07K 2317/92C07K 14/435C07K 2317/33A61P 21/02C07K 2317/34A61K 2039/505C07K 2317/30A61K 49/085C07K 16/40A61P 21/00C07K 2317/56
77
PatentIndex Score
0
Cited by
0
References
0
Claims

Abstract

Provided are novel human copper-zinc superoxide dismutase, also known as superoxide dismutase 1 or SOD1, specific antibodies as well as fragments, derivatives and variants thereof as well as methods related thereto. Assays, kits, and solid supports related to antibodies specific for SOD1 are also disclosed. The antibody, immunoglobulin chain(s), as well as binding fragments, derivatives and variants thereof can be used in pharmaceutical and diagnostic compositions for SOD1 targeted immunotherapy and diagnosis, respectively.

Claims

exact text as granted — not AI-modified
1 . A human monoclonal anti-SOD1 antibody, preferably characterized in that the antibody is capable of binding to misfolded or aggregated SOD1; and wherein the antibody binds to physiological SOD1 dimers, preferentially recognizes the misfolded or aggregated SOD1 over physiological SOD1 dimers, or does not substantially recognize physiological SOD1 dimers; and/or preferably binds to human wildtype and murine SOD1. 
     
     
         2 . The antibody of  claim 1 , which specifically binds an SOD1 epitope which comprises or consists of the amino acid sequence DGVADVS (SEQ ID NO: 2), GGPKDEERHVG (SEQ ID NO: 51), LKGDGPVQGIINFEQKESNGPVKVWGSIKGLTEGLHGFHVHE FGDNT (SEQ ID NO: 52), IIGRTLV (SEQ ID NO: 53), LGNVTADKDGV (SEQ ID NO: 54), HEKADDLGKGGNEES (SEQ ID NO: 55), EDSVISL (SEQ ID NO: 56), KTGNAGS (SEQ ID NO: 57), LGNVTADKDGV (SEQ ID NO: 58) or GGPKDEE (SEQ ID NO: 59). 
     
     
         3 . The antibody of  claim 1  or  2  or an SOD1 binding fragment thereof comprising in its variable region at least one complementarity determining region (CDR) as depicted in any one of  FIGS. 1A -IL, preferably comprising an amino acid sequence of the V H  and/or V L  region as depicted in any one of  FIGS. 1A -IL. 
     
     
         4 . An antibody or antigen-binding molecule which competes with an antibody of any one of  claims 1  to  3  for specific binding to SOD1. 
     
     
         5 . The antibody of any one of  claims 1  to  4 , which is selected from the group consisting of a chimeric murine-human or a murinized antibody and/or a single chain Fv fragment (scFv), an F(ab′) fragment, an F(ab) fragment, and an F(ab′) 2  fragment. 
     
     
         6 . A polynucleotide encoding at least the binding domain or variable region of an immunoglobulin chain of the antibody of any one of  claims 1  to  5 . 
     
     
         7 . A vector comprising the polynucleotide of  claim 6 , optionally in combination with a polynucleotide of  claim 6  that encodes the variable region of the other immunoglobulin chain of said binding molecule. 
     
     
         8 . A host cell comprising a polynucleotide of  claim 6  or a vector of  claim 7 . 
     
     
         9 . The antibody of any one of  claims 1  to  5 , which is:
 (i) detectably labeled, preferably wherein the detectable label is selected from the group consisting of an enzyme, a radioisotope, a fluorophore and a heavy metal; and/or 
 (ii) attached to a drug. 
 
     
     
         10 . A composition comprising the antibody of any one of  claims 1  to  5  or  9 , the polynucleotide of  claim 6 , the vector of  claim 7  or the cell of  claim 8 , which is preferably:
 (i) a pharmaceutical composition and further comprises a pharmaceutically acceptable carrier, preferably further comprising an additional agent useful for treating amyotrophic lateral sclerosis; or 
 (ii) a diagnostic composition, and optionally comprises reagents conventionally used in immuno or nucleic acid based diagnostic methods. 
 
     
     
         11 . An antibody of any one of  claims 1  to  5  or  9  or an SOD1 binding molecule having substantially the same binding specificities of any one thereof, the polynucleotide of  claim 6 , the vector of  claim 7  or the cell of  claim 8  for use in prophylactic or therapeutic treatment, or monitoring the progression or a response to a treatment of amyotrophic lateral sclerosis in a subject. 
     
     
         12 . A method of diagnosing or monitoring the progression of amyotrophic lateral sclerosis in a subject, the method comprising determining the presence of misfolded or aggregated SOD1 in a sample from the subject to be diagnosed with at least one antibody of any one of  claims 1  to  5  or  9 , wherein the presence of misfolded or aggregated SOD1 is indicative of amyotrophic lateral sclerosis and an increase of the level of the misfolded or aggregated SOD1 in comparison to the level of the physiological SOD1 dimers is indicative for progression of amyotrophic lateral sclerosis in said subject. 
     
     
         13 . An SOD1 binding molecule comprising at least one CDR of an antibody of any one of  claims 1  to  5  or  9  for use in in vivo detection of, or targeting a therapeutic and/or diagnostic agent to SOD1 in the human or animal body, preferably wherein said in vivo imaging comprises positron emission tomography (PET), single photon emission tomography (SPECT), near infrared (NIR) optical imaging or magnetic resonance imaging (MRI). 
     
     
         14 . A peptide having an epitope of SOD1 specifically recognized by an antibody of any one of the  claims 1  to  5  or  9 , preferably wherein the peptide comprises or consists of an amino acid sequence as defined in  claim 2  or a modified sequence thereof in which one or more amino acids are substituted, deleted and/or added, wherein the peptide is recognized by the antibody of any one of  claims 1  to  3 . 
     
     
         15 . A kit useful in the diagnosis or monitoring the progression of a amyotrophic lateral sclerosis, said kit comprising at least one antibody of any one of  claims 1  to  5  or  9  or an SOD1 binding molecule having substantially the same binding specificities of any one thereof, the polynucleotide of  claim 6 , the vector of  claim 7  or the cell of  claim 8  and/or the peptide of  claim 14 , optionally with reagents and/or instructions for use.

Join the waitlist — get patent alerts

Track US2022267471A1 — get alerts on status changes and closely related new filings.

We store only your email — no account needed. See our privacy policy.