US2022348925A1PendingUtilityA1
Compositions and methods for the targeting of sod1
Est. expirySep 9, 2039(~13.1 yrs left)· nominal 20-yr term from priority
Inventors:Benjamin OakesSean HigginsHannah SpinnerSarah DennyBrett T. StaahlKian TaylorKatherine BaneyIsabel ColinMaroof AdilCole Urnes
C12N 2750/14143C12N 9/22C12N 15/102C12N 2310/20C12N 15/1051C12N 15/111C12N 15/86C12N 15/101C12N 15/1137C12N 9/003C12N 15/907C12N 15/11A61P 25/28C12N 15/1133
63
PatentIndex Score
0
Cited by
0
References
0
Claims
Abstract
Provided herein are CasX:gNA systems comprising CasX polypeptides, guide nucleic acids (gNA), and optionally donor template nucleic acids useful in the modification of a SOD1 gene. The systems are also useful for introduction into cells, for example eukaryotic cells having mutations in the SOD1 protein or the SOD1 regulatory element. Also provided are methods of using such CasX:gNA systems to modify cells having such mutations and utility in methods of treatment of a subject with a SOD1-related disease.
Claims
exact text as granted — not AI-modifiedWhat is claimed is:
1 . A CasX:gNA system comprising a CasX protein and a first guide nucleic acid (gNA), wherein the gNA comprises a targeting sequence complementary to a superoxide dismutase 1 (SOD1) gene target nucleic acid sequence, wherein the SOD1 gene comprises one or more mutations.
2 . The CasX:gNA system of claim 1 , wherein the SOD1 gene comprises one or more mutations in a region selected from the group consisting of:
a. a SOD1 intron; b. a SOD1 exon; c. a SOD1 intron-exon junction; d. a SOD1 regulatory element; and e. an intergenic region.
3 . The CasX:gNA system of claim 1 , wherein the SOD1 gene comprises a wild-type sequence in either:
a. the sequence encoding SOD1 protein; or b. the sequence encoding the regulatory element.
4 . The CasX:gNA system of claim 1 or claim 2 , wherein the mutation is an insertion, deletion, substitution, duplication, or inversion of one or more nucleotides as compared to the wild-type SOD1 gene sequence.
5 . The CasX:gNA system any one of claims 1 , 2 or 4 , wherein the mutation is a gain of function mutation.
6 . The CasX:gNA system any one of claims 1 , 2 or 4 , wherein the mutation is a loss of function mutation.
7 . The CasX:gNA system of any one of claims 1 , 2 or 4 - 6 , wherein the SOD1 gene encodes a protein comprising one or more mutations selected from mutations set forth in Table 1 or comprises one or more mutations that disrupt the function or expression of the SOD1 protein.
8 . The CasX:gNA system any one of claims 1 , 2 , or 4 - 6 , wherein the SOD1 gene encodes a protein comprising one or more mutations selected from the group of amino acid substitutions of SEQ ID NO:100 consisting of A4S, A4T, A4V, C6F, V7E, L8Q, L8V, G12R, V14G, V14M, G16S, F20C, E21G, E21K, Q22L, G37R, L38R, L38V, G41D, G41S, H43R, F45C, H46R, H48Q, H48R, E49K, T54R, N65S, L67P, L67R, G72S, D76Y, H80A, L84F, L84V, G85R, N86S, V87A, A89T, A89V, D90A, D90V, G93A, G93C, G93D, G93R, G93V, A95G, V97M, E100G, E100K, D101G, D101N, I104F, S105L, L106V, G108V, C111Y, I112M, I112T, I113T, G114A, R115G, V118L, D124G, D124V, D125H, L126S, S134N, N139K, L144F, L144S, A145T, C146R, G147R, V148G, V148I, I149T, 1151T and one or more amino acid substitutions of SEQ ID NO:100 that disrupt a function or expression of the SOD1 protein.
9 . The CasX:gNA system of claim 8 , wherein the SOD1 gene encodes a protein comprising a mutation selected from an A4V mutation of SEQ ID NO:100, a D90A mutation of SEQ ID NO:100, a G93A mutation of SEQ ID NO:100, or a combination thereof.
10 . The CasX:gNA system of any one of claims 1 - 9 , wherein the gNA is a guide RNA (gRNA).
11 . The CasX:gNA system of any one of claims 1 - 9 , wherein the gNA is a guide DNA (gDNA).
12 . The CasX:gNA system of any one of claims 1 - 9 , wherein the gNA is a chimera comprising DNA and RNA.
13 . The CasX:gNA system of any one of claims 1 - 12 , wherein the gNA is a single-molecule gNA (sgNA).
14 . The CasX:gNA system of any one of claims 1 - 12 , wherein the gNA is a dual-molecule gNA (dgNA).
15 . The CasX:gNA system of any one of claims 1 - 14 , wherein the targeting sequence of the gNA comprises a sequence selected from the group consisting of SEQ ID NOs: 372-2100 and 2281-12495, or a sequence having at least about 65%, at least about 75%, at least about 85%, or at least about 95% identity thereto.
16 . The CasX:gNA system of any one of claims 1 - 14 , wherein the targeting sequence of the gNA comprises a sequence of SEQ ID NOs: 372-2100 or 2281-12495 with a single nucleotide removed from the 3′ end of the sequence.
17 . The CasX:gNA system of any one of claims 1 - 14 , wherein the targeting sequence of the gNA comprises a sequence of SEQ ID NOs: 372-2100 or 2281-12495 with two nucleotides removed from the 3′ end of the sequence.
18 . The CasX:gNA system of any one of claims 1 - 14 , wherein the targeting sequence of the gNA comprises a sequence of SEQ ID NOs: 372-2100 or 2281-12495 with three nucleotides removed from the 3′ end of the sequence.
19 . The CasX:gNA system of any one of claims 1 - 14 , wherein the targeting sequence of the gNA comprises a sequence of SEQ ID NOs: 372-2100 or 2281-12495 with four nucleotides removed from the 3′ end of the sequence.
20 . The CasX:gNA system of any one of claims 1 - 14 , wherein the targeting sequence of the gNA comprises a sequence of SEQ ID NOs: 372-2100 or 2281-12495 with five nucleotides removed from the 3′ end of the sequence.
21 . The CasX:gNA system of any one of claims 1 - 20 , wherein the targeting sequence of the gNA is complementary to a sequence of a SOD1 exon.
22 . The CasX:gNA system of claim 21 , wherein the targeting sequence of the gNA is complementary to a sequence of SOD1 exon 1, SOD1 exon 2, SOD1 exon 3, SOD1 exon 4, or SOD1 exon 5.
23 . The CasX:gNA system of any one of claims 1 - 20 , wherein the targeting sequence of the gNA is complementary to a sequence of a SOD1 intron.
24 . The CasX:gNA system of any one of claims 1 - 20 , wherein the targeting sequence of the gNA is complementary to a sequence of a SOD1 intron-exon junction.
25 . The CasX:gNA system of any one of claims 1 - 20 , wherein the targeting sequence of the gNA is complementary to a sequence comprising one or more single nucleotide polymorphisms (SNPs) of the SOD1 gene.
26 . The CasX:gNA system of any one of claims 1 - 20 , wherein the targeting sequence of the gNA is complementary to a sequence of an intergenic region of the SOD1 gene.
27 . The CasX:gNA system of any one of claims 1 - 14 , wherein the targeting sequence is complementary to a nucleic acid sequence encoding a mutation of the SOD1 protein of SEQ ID NO:100 selected from the group of amino acid substitutions consisting of A4S, A4T, A4V, C6F, V7E, L8Q, L8V, G12R, V14G, V14M, G16S, F20C, E21G, E21K, Q22L, G37R, L38R, L38V, G41D, G41S, H43R, F45C, H46R, H48Q, H48R, E49K, T54R, N65S, L67P, L67R, G72S, D76Y, H80A, L84F, L84V, G85R, N86S, V87A, A89T, A89V, D90A, D90V, G93A, G93C, G93D, G93R, G93V, A95G, V97M, E100G, E100K, D101G, D101N, I104F, S105L, L106V, G108V, C111Y, I112M, I112T, I113T, G114A, R115G, V118L, D124G, D124V, D125H, L126S, S134N, N139K, L144F, L144S, A145T, C146R, G147R, V148G, V148I, I149T, I151T, and one or more amino acid substitutions of SEQ ID NO:100 that disrupt the function or expression of the SOD1 protein.
28 . The CasX:gNA system of any one of claims 1 - 27 , further comprising a second gNA, wherein the second gNA has a targeting sequence complementary to a different or overlapping portion of the SOD1 target nucleic acid compared to the targeting sequence of the gNA of the first gNA.
29 . The CasX:gNA system of any one of claims 1 - 28 , wherein the first or second gNA has a scaffold comprising a sequence having at least about 50%, at least about 60%, at least about 70%, at least about 80%, at least about 90%, at least about 95%, at least about 96%, at least about 97%, at least about 98%, at least about 99%, or 100% sequence identity to a sequence selected from the group consisting of SEQ ID NOs: 4-16 and 2101-2280.
30 . The CasX:gNA system of claim 29 , wherein the first or second gNA scaffold comprises a sequence having at least one modification relative to a reference gNA sequence selected from the group consisting of SEQ ID NOS: 4-16.
31 . The CasX:gNA system of claim 30 , wherein the at least one modification of the reference gNA comprises at least one substitution, deletion, or substitution of a nucleotide of the reference gNA sequence.
32 . The CasX:gNA system of any one of claims 1 - 31 , wherein the first or second gNA is chemically modified.
33 . The CasX:gNA system of any one of claims 1 - 32 , wherein the CasX protein comprises a reference CasX protein having a sequence of any one of SEQ ID NOS: 1-3, a CasX variant protein having a sequence of SEQ ID NOs: 36-131, 208, 210, 212, 214, 216-229, 240, 242, 244, 246, 248, 250, 252, 254, 256 or 258, or a sequence having at least about 50%, at least about 60%, at least about 70%, at least about 80%, at least about 90%, or at least about 95%, or at least about 95%, or at least about 96%, or at least about 97%, or at least about 98%, or at least about 99% sequence identity thereto.
34 . The CasX:gNA system of claim 33 , wherein the CasX variant protein comprises at least one modification relative to a reference CasX protein having a sequence selected from SEQ ID NOS:1-3.
35 . The CasX:gNA system of claim 34 , wherein the at least one modification comprises at least one amino acid substitution, deletion, or substitution in a domain of the CasX variant protein relative to the reference CasX protein.
36 . The CasX:gNA system of claim 35 , wherein the domain is selected from the group consisting of a non-target strand binding (NTSB) domain, a target strand loading (TSL) domain, a helical I domain, a helical II domain, an oligonucleotide binding domain (OBD), and a RuvC DNA cleavage domain.
37 . The CasX:gNA system of any one of claims 33 - 36 , wherein the CasX protein further comprises one or more nuclear localization signals (NLS).
38 . The CasX:gNA system of claim 37 , wherein the one or more NLS are selected from the group of sequences consisting of PKKKRKV (SEQ ID NO: 145), KRPAATKKAGQAKKKK (SEQ ID NO: 146), PAAKRVKLD (SEQ ID NO: 147), RQRRNELKRSP (SEQ ID NO: 148), NQSSNFGPMKGGNFGGRSSGPYGGGGQYFAKPRNQGGY (SEQ ID NO: 149), RMRIZFKNKGKDTAELRRRRVEVSVELRKAKKDEQILKRRNV (SEQ ID NO: 150), VSRKRPRP (SEQ ID NO: 151), PPKKARED (SEQ ID NO: 152), PQPKKKPL (SEQ ID NO: 153), SALIKKKKKMAP (SEQ ID NO: 154), DRLRR (SEQ ID NO: 155), PKQKKRK (SEQ ID NO: 156), RKLKKKIKKL (SEQ ID NO: 157), REKKKFLKRR (SEQ ID NO: 158), KRKGDEVDGVDEVAKKKSKK (SEQ ID NO: 159), RKCLQAGMNLEARKTKK (SEQ ID NO: 160), PRPRKIPR (SEQ ID NO: 161), PPRKKRTVV (SEQ ID NO: 162), NLSKKKKRKREK (SEQ ID NO: 163), RRPSRPFRKP (SEQ ID NO: 164), KRPRSPSS (SEQ ID NO: 165), KRGINDRNFWRGENERKTR (SEQ ID NO: 166), PRPPKMARYDN (SEQ ID NO: 167), KRSFSKAF (SEQ ID NO: 168), KLKIKRPVK (SEQ ID NO: 169), PKTRRRPRRSQRKRPPT (SEQ ID NO: 171), RRKKRRPRRKKRR (SEQ ID NO: 174), PKKKSRKPKKKSRK (SEQ ID NO: 175), HKKKHPDASVNFSEFSK (SEQ ID NO: 176), QRPGPYDRPQRPGPYDRP (SEQ ID NO: 177), LSPSLSPLLSPSLSPL (SEQ ID NO: 178), RGKGGKGLGKGGAKRHRK (SEQ ID NO: 179), PKRGRGRPKRGRGR (SEQ ID NO: 180), MSRRRKANPTKLSENAKKLAKEVEN (SEQ ID NO: 205), PKKKRKVPPPPAAKRVKLD (SEQ ID NO: 181), and PKKKRKVPPPPKKKRKV (SEQ ID NO: 182).
39 . The CasX:gNA system of claim 37 or claim 38 , wherein the one or more NLS are expressed at or near the C-terminus of the CasX protein.
40 . The CasX:gNA system of claim 37 or claim 38 , wherein the one or more NLS are expressed at or near the N-terminus of the CasX protein.
41 . The CasX:gNA system of claim 37 or claim 38 , comprising one or more NLS located at or near the N-terminus and at or near the C-terminus of the CasX protein.
42 . The CasX:gNA system of any one of claims 33 - 41 , wherein the CasX variant is capable of forming a ribonuclear protein complex (RNP) with a guide nucleic acid (gNA).
43 . The CasX:gNA system of claim 43 , wherein an RNP of the CasX variant protein and the gNA variant exhibit at least one or more improved characteristics as compared to an RNP of a reference CasX protein of SEQ ID NO: 1, SEQ ID NO: 2, or SEQ ID NO: 3 and a gNA comprising a sequence of SEQ ID NOs: 4-16.
44 . The CasX:gNA system of claim 43 , wherein the improved characteristic is selected from one or more of the group consisting of improved folding of the CasX variant; improved binding affinity to a guide nucleic acid (gNA); improved binding affinity to a target DNA; improved ability to utilize a greater spectrum of one or more PAM sequences, including ATC, CTC, GTC, or TTC, in the editing of target DNA; improved unwinding of the target DNA; increased editing activity; improved editing efficiency; improved editing specificity; increased nuclease activity; increased target strand loading for double strand cleavage; decreased target strand loading for single strand nicking; decreased off-target cleavage; improved binding of non-target DNA strand; improved protein stability; improved protein solubility; improved protein:gNA complex (RNP) stability; improved protein:gNA complex solubility; improved protein yield; improved protein expression; and improved fusion characteristics.
45 . The CasX:gNA system of claim 43 or claim 44 , wherein the improved characteristic of the RNP of the CasX variant protein and the gNA variant is at least about 1.1 to about 100-fold or more improved relative to the RNP of the reference CasX protein of SEQ ID NO: 1, SEQ ID NO: 2, or SEQ ID NO: 3 and the gNA comprising a sequence of SEQ ID NOs: 4-16.
46 . The CasX:gNA system of claim 43 or claim 44 , wherein the improved characteristic of the CasX variant protein is at least about 1.1, at least about 2, at least about 10, at least about 100-fold or more improved relative to the reference CasX protein of SEQ ID NO: 1, SEQ ID NO: 2, or SEQ ID NO: 3 and the gNA comprising a sequence of SEQ ID NOs: 4-16.
47 . The CasX:gNA system of any one of claims 43 - 46 , wherein the improved characteristic comprises editing efficiency, and the RNP of the CasX variant protein and the gNA variant comprises a 1.1 to 100-fold improvement in editing efficiency compared to the RNP of the reference CasX protein of SEQ ID NO: 2 and the gNA of SEQ ID NOs: 4-16.
48 . The CasX:gNA system of any one of claims 42 - 47 , wherein the RNP comprising the CasX variant and the gNA variant exhibits greater editing efficiency and/or binding of a target sequence in the target DNA when any one of the PAM sequences TTC, ATC, GTC, or CTC is located 1 nucleotide 5′ to the non-target strand of the protospacer having identity with the targeting sequence of the gNA in a cellular assay system compared to the editing efficiency and/or binding of an RNP comprising a reference CasX protein and a reference gNA in a comparable assay system.
49 . The CasX:gNA system of claim 48 , wherein the PAM sequence is TTC.
50 . The CasX:gNA system of claim 48 , wherein the PAM sequence is ATC.
51 . The CasX:gNA system of claim 48 , wherein the PAM sequence is CTC.
52 . The CasX:gNA system of claim 48 , wherein the PAM sequence is GTC.
53 . The CasX:gNA system of any one of claims 48 - 52 , wherein the increased binding affinity for the one or more PAM sequences is at least 1.5-fold greater compared to the binding affinity of any one of the CasX proteins of SEQ ID NOS: 1-3 for the PAM sequences.
54 . The CasX:gNA system of any one of claims 42 - 53 , wherein the RNP has at least a 5%, at least a 10%, at least a 15%, or at least a 20% higher percentage of cleavage-competent RNP compared to an RNP of the reference CasX and the gNA of SEQ ID NOs: 4-16.
55 . The CasX:gNA system of any one of claims 33 - 54 , wherein the CasX variant protein comprises a RuvC DNA cleavage domain having nickase activity.
56 . The CasX:gNA system of any one of claims 33 - 54 , wherein the CasX variant protein comprises a RuvC DNA cleavage domain having double-stranded cleavage activity.
57 . The CasX:gNA system of any one of claims 1 - 42 , wherein the CasX protein is a catalytically inactive CasX (dCasX) protein, and wherein the dCasX and the gNA retain the ability to bind to the SOD1 target nucleic acid.
58 . The CasX:gNA system of claim 57 , wherein the dCasX comprises a mutation at residues:
a. D672, E769, and/or D935 corresponding to the CasX protein of SEQ ID NO:1; or b. D659, E756 and/or D922 corresponding to the CasX protein of SEQ ID NO: 2.
59 . The CasX:gNA system of claim 58 , wherein the mutation is a substitution of alanine for the residue.
60 . The CasX:gNA system of any one of claims 1 - 56 , further comprising a donor template nucleic acid.
61 . The CasX:gNA system of claim 60 , wherein the donor template comprises a nucleic acid comprising at least a portion of a SOD1 gene, selected from the group consisting of a SOD1 exon, a SOD1 intron, a SOD1 exon, a SOD1 intron-exon junction, and a SOD1 regulatory element.
62 . The CasX:gNA system of claim 60 or claim 61 , wherein the donor template ranges in size from 10-15,000 nucleotides.
63 . The CasX:gNA system of any one of claims 60 - 62 , wherein the donor template is a single-stranded DNA template or a single stranded RNA template.
64 . The CasX:gNA system of any one of claims 60 - 62 , wherein the donor template is a double-stranded DNA template.
65 . The CasX:gNA system of any one of claims 60 - 64 , wherein the donor template comprises one or more mutations compared to a wild-type SOD1 gene.
66 . The CasX:gNA system of any one of claims 60 - 64 , wherein the donor template comprises all or a portion of a wild-type SOD1 gene.
67 . The CasX:gNA system of any one of claims 60 - 66 , wherein the donor template comprises homologous arms at or near the 5′ and 3′ ends of the donor template that are complementary to sequences flanking a cleavage site in the SOD1 target nucleic acid introduced by the CasX:gNA system.
68 . A nucleic acid comprising the donor template of any one of claims 60 - 67 .
69 . A nucleic acid comprising a sequence that encodes the CasX of any one of claims 33 - 59 .
70 . A nucleic acid comprising a sequence that encodes the gNA of any one of claims 1 - 32 .
71 . The nucleic acid of claim 69 , wherein the sequence that encodes the CasX protein is codon optimized for expression in a eukaryotic cell.
72 . A vector comprising the nucleic acid of any one of claims 68 - 71 .
73 . The vector of claim 72 , wherein the vector further comprises a promoter.
74 . The vector of claim 72 or claim 73 , wherein the vector is selected from the group consisting of a retroviral vector, a lentiviral vector, an adenoviral vector, an adeno-associated viral (AAV) vector, a herpes simplex virus (HSV) vector, a virus-like particle (VLP), a plasmid, a minicircle, a nanoplasmid, a DNA vector, and an RNA vector.
75 . The vector of claim 74 , wherein the vector is an AAV vector.
76 . The vector of claim 75 , wherein the AAV vector is selected from AAV1, AAV2, AAV3, AAV4, AAV5, AAV6, AAV7, AAV8, AAV9, AAV10, AAV-Rh74, or AAVRh10.
77 . The vector of claim 74 , wherein the vector is a retroviral vector.
78 . The vector of claim 74 , wherein the vector is a VLP vector comprising a gag polyprotein.
79 . The vector of claim 78 , comprising the CasX protein of any one of claims 33 - 56 , and the gNA of any one of claims 1 - 32 .
80 . The vector of claim 79 , wherein the CasX protein and the gNA are associated together in an RNP.
81 . The vector of claim 79 and claim 80 , further comprising a donor template.
82 . A VLP comprising the nucleic acid of any one of claims of 68-71.
83 . A host cell comprising the vector of any one of claims 72 - 81 .
84 . The host cell of claim 81 , wherein the host cell is selected from the group consisting of BHK, HEK293, HEK293T, NS0, SP2/0, YO myeloma cells, P3X63 mouse myeloma cells, PER, PER.C6, NIH3T3, COS, HeLa, CHO, and yeast cells.
85 . A method of modifying a SOD1 target nucleic acid sequence in a population of cells, the method comprising introducing into each cell of the population:
a. the CasX:gNA system of any one of claims 1 - 67 ; b. the nucleic acid of any one of claims 68 - 71 ; c. the vector as in any one of claims 72 - 78 ; d. the VLP of any one of claims 79 - 81 ; or e. combinations of two or more of (a)-(d),
wherein the SOD1 gene target nucleic acid sequence of the cells is modified by the CasX protein.
86 . The method of claim 85 , wherein the modifying comprises introducing a single-stranded break in the SOD1 gene target nucleic acid sequence of the cells of the population.
87 . The method of claim 85 , wherein the modifying comprises introducing a double-stranded break in the SOD1 gene target nucleic acid sequence of the cells of the population.
88 . The method of any one of claims 85 - 87 , wherein the modifying comprises introducing an insertion, deletion, substitution, duplication, or inversion of one or more nucleotides in the SOD1 gene of the cells of the population.
89 . The method of any one of claims 85 - 88 , further comprising introducing into a plurality of cells of the population a second gNA or a nucleic acid encoding the second gNA, wherein the second gNA has a targeting sequence complementary to a different or overlapping portion of the SOD1 gene target nucleic acid compared to the first gNA, resulting in an additional break in the SOD1 target nucleic acid of the cells of the population.
90 . The method of any one of claims 85 - 89 , wherein the method comprises insertion of the donor template into the break site(s) of the SOD1 gene target nucleic acid sequence of the cells of the population.
91 . The method of claim 90 , wherein the insertion of the donor template is mediated by homology-directed repair (HDR) or homology-independent targeted integration (HITI).
92 . The method of claim 90 or claim 91 , wherein insertion of the donor template results in a knock-down or knock-out of the SOD1 gene in the cells of the population.
93 . The method of any one of claims 85 - 92 , wherein the SOD1 gene of the cells of the population is modified such that expression of the SOD1 protein is reduced by at least about 10%, at least about 20%, at least about 30%, at least about 40%, at least about 50%, at least about 60%, at least about 70%, at least about 80%, or at least about 90% in comparison to cells that have not been modified.
94 . The method of any one of claims 85 - 92 , wherein the SOD1 gene of the cells of the population is modified such that expression of the SOD1 protein by the cells cannot be detected.
95 . The method of claim 90 or claim 91 , wherein insertion of the donor template results in correction of the one or more mutations of the SOD1 gene in the cells of the population.
96 . The method of claim 95 , wherein the correction of the one or more mutations of the SOD1 gene results in expression of a functional SOD1 protein by the modified cells.
97 . The method of any one of claims 81 - 96 , wherein the cells are eukaryotic.
98 . The method of claim 97 , wherein the eukaryotic cells are selected from the group consisting of rodent cells, mouse cells, rat cells, and non-human primate cells.
99 . The method of claim 97 , wherein the eukaryotic cells are human cells.
100 . The method of any one of claims 97 - 99 , wherein the eukaryotic cells are selected from the group consisting of embryonic stem (ES) cells, induced pluripotent stem cell (iPSC), central nervous system (CNS) cells, and peripheral nervous system (PNS) cells.
101 . The method of claim 100 , wherein the eukaryotic cells comprise neuron cells of the CNS or the PNS.
102 . The method of claim 101 , wherein the neuron cells comprise spinal motor neuron cells or oligodendrocyte cells.
103 . The method of claim 100 , wherein the population of eukaryotic cells comprise glial cells or Schwann cells of the PNS.
104 . The method of any one of claim 81 - 103 , wherein the modifying of the SOD1 gene target nucleic acid sequence of the population of cells occurs in vitro or ex vivo.
105 . The method of claims 81 - 103 , wherein the modifying of the SOD1 gene target nucleic acid sequence of the population of cells occurs in vivo in a subject.
106 . The method of claim 105 , wherein the vector is administered to the subject at a therapeutically effective dose.
107 . The method of claim 105 , wherein the vector is administered to the subject at a dose of at least about 1×10 8 vector genomes (vg), at least about 1×10 9 vg, at least about 1×10 10 vg at least about 1×10 11 vg, or at least about 1×10 12 vg, or at least about 1×10 13 vg, or at least about 1×10 14 vg, or at least about 1×10 15 vg, or at least about 1×10 16 vg.
108 . The method of claim 105 , wherein the VLP is administered to the subject at a therapeutically effective dose.
109 . The method of claim 105 , wherein the VLP is administered to the subject at a dose of at least about 1×10 8 particles, at least about 1×10 9 particles, at least about 1×10 10 particles at least about 1×10 11 particles, or at least about 1×10 12 particles, or at least about 1×10 13 particles, or at least about 1×10 14 particles, or at least about 1×10 15 particles, or at least about 1×10 16 particles.
110 . The method of any one of claims 106 - 109 , wherein the vector or VLP is administered to the subject by a route of administration selected from intraparenchymal, intravenous, intra-arterial, intracerebroventricular, intracisternal, intrathecal, intracranial, lumbar, intraperitoneal, or combinations thereof.
111 . The method of any one of claims 81 - 110 , further comprising contacting the SOD1 gene target nucleic acid sequence of the population of cells with:
a. an additional CRISPR nuclease and a gNA targeting a different or overlapping portion of the SOD1 target nucleic acid compared to the first gNA; b. a polynucleotide encoding the additional CRISPR nuclease and the gNA of (a); c. a vector comprising the polynucleotide of (b); or d. a VLP comprising the additional CRISPR nuclease and the gNA of (a)
wherein the contacting results in modification of the SOD1 gene at a different location in the sequence compared to the sequence targeted by the first gNA.
112 . The method of claim 111 , wherein the additional CRISPR nuclease is a CasX protein having a sequence different from the CasX protein of any of the preceding claims.
113 . The method of claim 111 , wherein the additional CRISPR nuclease is not a CasX protein.
114 . The method of claim 113 , wherein the additional CRISPR nuclease is selected from the group consisting of Cas9, Cas12a, Cas12b, Cas12c, Cas12d (CasY), Cas13a, Cas13b, Cas13c, Cas13d, CasX, CasY, Cas14, Cpfl, C2cl, Csn2, Cas Phi, and sequence variants thereof.
115 . A population of cells modified by the method of any one of claims 81 - 114 , wherein the cells have been modified such that at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, or at least 95% of the modified cells do not express a detectable level of SOD1 protein.
116 . A population of cells modified by the method of any one of claims 81 - 114 , wherein the cells have been modified such that the expression of SOD1 protein is reduced by at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, or at least 95% compared to cells that have not been modified.
117 . A population of cells modified by the method of any one of claims 81 - 114 , wherein the mutation of the SOD1 gene is corrected in the modified cells of the population, resulting in expression of a functional SOD1 protein by the modified cells.
118 . A method of treating a SOD1-related disorder in a subject in need thereof, the method comprising administering to the subject a therapeutically effective amount of the cells of claim 117 .
119 . The method of claim 118 , wherein the SOD1-related disorder is amyotrophic lateral sclerosis (ALS).
120 . The method of claim 118 or claim 119 , wherein the cells are autologous with respect to the subject to be administered the cells.
121 . The method of claim 118 or claim 119 , wherein the cells are allogeneic with respect to the subject to be administered the cells.
122 . The method of any one of claim 118 , wherein the method further comprises administering a chemotherapeutic agent.
123 . A method of treating a SOD1-related disorder in a subject in need thereof, comprising modifying a SOD1 gene having one or more mutations in cells of the subject, the modifying comprising contacting said cells with a therapeutically effective dose of:
a. the CasX:gNA system of any one of claims 1 - 67 ; b. the nucleic acid of any one of claims 68 - 71 ; c. the vector as in any one of claims 72 - 78 ; d. the VLP of any one of claims 79 - 82 ; or e. combinations of two or more of (a)-(d), wherein the SOD1 gene of the cells is modified by the CasX protein.
124 . The method of claim 123 , wherein the modifying comprises introducing a single-stranded break in the SOD1 gene of the cells.
125 . The method of any one of claim 123 , wherein the modifying comprises introducing a double-stranded break in the SOD1 gene of the cells.
126 . The method of any one of claims 123 - 125 , wherein the modifying comprises introducing an insertion, deletion, substitution, duplication, or inversion of one or more nucleotides in the SOD1 gene of the cells.
127 . The method of any one of claims 123 - 126 , further comprising introducing into the cells of the subject a second gNA or a nucleic acid encoding the second gNA, wherein the second gNA has a targeting sequence complementary to a different or overlapping portion of the target nucleic acid compared to the first gNA, resulting in an additional break in the SOD1 target nucleic acid of the cells of the subject.
128 . The method of any one of claims 123 - 127 , wherein the method comprises insertion of the donor template into the break site(s) of the SOD1 gene target nucleic acid sequence of the cells.
129 . The method of claim 128 , wherein the insertion of the donor template is mediated by homology-directed repair (HDR) or homology-independent targeted integration (HITI).
130 . The method of claim 128 or claim 129 , wherein insertion of the donor template results in a knock-down or knock-out of the SOD1 gene in the modified cells of the subject.
131 . The method of any one of claims 123 - 130 , wherein the SOD1 gene of the cells are modified such that expression of the SOD1 protein is reduced by at least about 10%, at least about 20%, at least about 30%, at least about 40%, at least about 50%, at least about 60%, at least about 70%, at least about 80%, or at least about 90% in comparison to cells that have not been modified.
132 . The method of any one of claims 123 - 130 , wherein the SOD1 gene of the cells of the subject are modified such that at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, or at least 95% of the modified cells do not express a detectable level of SOD1 protein.
133 . The method of claim 128 or claim 129 , wherein in insertion of the donor template results in correction of the one or more mutations of the SOD1 gene in the modified cells of the subject.
134 . The method of claim 133 , wherein the correction of the one or more mutations of the SOD1 gene results in expression of functional SOD1 protein by the modified cells of the subject.
135 . The method of any one of claims 123 - 134 , wherein the subject is selected from the group consisting of rodent, mouse, rat, and non-human primate.
136 . The method of any one of claims 123 - 134 , wherein the subject is a human.
137 . The method of claim 135 or claim 136 , wherein the SOD1-related disorder is amyotrophic lateral sclerosis (ALS).
138 . The method of any one of claims 123 - 137 , wherein the vector is administered to the subject at a dose of at least about 1×10 8 vector genomes (vg), at least about 1×10 9 vg, at least about 1×10 10 vg at least about 1×10 11 vg, or at least about 1×10 12 vg, or at least about 1×10 13 vg, or at least about 1×10 14 vg, or at least about 1×10 15 vg, or at least about 1×10 16 vg.
139 . The method of any one of claims 123 - 138 , wherein the VLP is administered to the subject at a dose of at least about 1×10 8 particles, at least about 1×10 9 particles, at least about 1×10 10 particles at least about 1×10 11 particles, or at least about 1×10 12 particles, or at least about 1×10 13 particles, or at least about 1×10 14 particles, or at least about 1×10 15 particles, or at least about 1×10 16 particles.
140 . The method of any one of claims 123 - 139 , wherein the vector or VLP is administered to the subject by a route of administration selected from intraparenchymal, intravenous, intra-arterial, intracerebroventricular, intracisternal, intrathecal, intracranial, lumbar, intraperitoneal, or combinations thereof.
141 . The method of any one of claims 123 - 140 , wherein the method results in improvement in at least one clinically-relevant endpoint selected from the group consisting of ALS Functional Rating Scale (ALSFRS-(R)), combined assessment of function and survival, duration of response, time to death, time to tracheostomy, time to persistent assisted ventilation (DTP), forced vital capacity (% FVC); manual muscle test, maximum voluntary isometric contraction, duration of response, progression-free survival, time to progression of disease, and time-to-treatment failure.
142 . The method of any one of claims 123 - 141 , wherein the method results in improvement in at least two clinically-relevant endpoints selected from the group consisting of ALS Functional Rating Scale (ALSFRS-(R)), combined assessment of function and survival, duration of response, time to death, time to tracheostomy, time to persistent assisted ventilation (DTP), forced vital capacity (% FVC); manual muscle test, maximum voluntary isometric contraction, duration of response, progression-free survival, time to progression of disease, and time-to-treatment failure.
143 . The CasX:gNA system of any one of claims 1 - 56 , the nucleic acid of any one of claims 68 - 71 , the vector of any one of 72 - 81 , the VLP of claim 82 , the host cell of any one of claims 83 - 85 , or the population of cells of any one of claims 115 - 117 , for use as a medicament for the treatment of a SOD1 related disorder.
144 . The CasX:gNA system of any one of claims 1 - 56 , the nucleic acid of any one of claims 68 - 71 , the vector of any one of 72 - 81 , the VLP of claim 82 , the host cell of any one of claims 83 - 85 , or the population of cells of any one of claims 115 - 117 , for use in a method of treatment of a SOD1-related disorder in a subject in need thereof.
145 . A guide nucleic acid (gNA) comprising a targeting sequence complementary to a target nucleic acid sequence in the target strand of a gene encoding a SOD1 protein, wherein the gNA is capable of forming a complex with a CRISPR protein that is specific to a protospacer adjacent motif (PAM) sequence comprising a TC motif in the complementary non-target strand, and wherein the PAM sequence is located 1 nucleotide 5′ of the sequence in the non-target strand that is complementary to the target nucleic acid sequence in the target strand.
146 . The gNA of claim 145 , wherein the CRISPR protein is specific for a TC PAM sequence.
147 . The gNA of claim 145 , wherein the CRISPR protein is specific for a TTC PAM sequence.
148 . The gNA of claim 145 , wherein the CRISPR protein is specific for an ATC PAM sequence.
149 . The gNA of claim 145 , wherein the CRISPR protein is specific for a CTC PAM sequence.
150 . The gNA of claim 145 , wherein the CRISPR protein is specific for a GTC PAM sequence.
151 . The gNA any one of claims 145 - 150 , wherein the targeting sequence is located at the 3′ end of the gNA.
152 . The gNA of any one of claims 145 - 151 , wherein the CRISPR protein is a Type V CRISPR protein.
153 . The gNA of claim 145 - 152 , wherein the targeting sequence of the gNA comprises a sequence selected from the group consisting of SEQ ID NOs: 372-2100 and 2281-12495 or a sequence having at least about 65%, at least about 75%, at least about 85%, or at least about 95% identity thereto.
154 . The gNA of claim 145 - 152 , wherein the targeting sequence of the gNA comprises a sequence selected from the group consisting of SEQ ID NOs: 372-2100 and 2281-12495.
155 . The gNA of any one of claims 145 - 154 , wherein the gNA is a guide RNA (gRNA).
156 . The gNA of any one of claims 145 - 154 , wherein the gNA is a guide DNA (gDNA).
157 . The gNA of any one of claims 145 - 154 , wherein the gNA is a chimera comprising DNA and RNA.
158 . The gNA of any one of claims 145 - 154 , wherein the gNA is a single-molecule gNA (sgNA).
159 . The gNA of any one of claims 145 - 154 , wherein the gNA is a dual-molecule gNA (dgNA).
160 . The gNA of any one of claims 145 - 159 , wherein the targeting sequence of the gNA comprises 15, 16, 17, 18, 19, or 20 nucleotides.
161 . The gNA of any one of claims 145 - 160 , wherein the gNA has a scaffold comprising a sequence selected from the group consisting of reference gNA sequences of SEQ ID NOS: 4-16 or gNA variant sequences of SEQ ID NOS:2101-2280, or a sequence having at least about 50%, at least about 60%, at least about 70%, at least about 80%, at least about 90%, at least about 95%, at least about 96%, at least about 97%, at least about 98%, or at least about 99% sequence identity thereto.
162 . The gNA of claim 161 , wherein the gNA variant scaffold comprises a sequence having at least one modification relative to a reference gNA sequence selected from the group consisting of SEQ ID NOS:4-16.
163 . The gNA of claim 162 , wherein the at least one modification of the reference gNA comprises at least one substitution, deletion, or substitution of a nucleotide of the gNA sequence.
164 . The gNA of any one of claims 145 - 163 , wherein the gNA is chemically modified.
165 . The gNA of any one of claims 145 - 163 , wherein the gNA can from a ribonuclear protein complex (RNP) with a Class II Type V CRISPR-Cas protein.
166 . The gNA of claim 165 , wherein the Class II Type V CRISPR-Cas protein is comprises any one of SEQ ID NOS:1-3, 36-131, 208, 210, 212, 214, 216-229, 240, 242, 244, 246, 248, 250, 252, 254, 256 or 258, or a sequence having at least about 50%, at least about 60%, at least about 70%, at least about 80%, at least about 90%, or at least about 95%, or at least about 95%, or at least about 96%, or at least about 97%, or at least about 98%, or at least about 99% sequence identity thereto.
167 . The gNA of claim 165 , wherein the Class II Type V CRISPR-Cas protein comprises SEQ ID NOS: 36-131, 208, 210, 212, 214, 216-229, 240, 242, 244, 246, 248, 250, 252, 254, 256 or 258.
168 . A Class II Type V CRISPR protein, wherein an RNP comprising the CRISPR protein and a gNA at a concentration of 20 pM or less is capable of cleaving a double stranded DNA target with an efficiency of at least 80%.Join the waitlist — get patent alerts
Track US2022348925A1 — get alerts on status changes and closely related new filings.
We store only your email — no account needed. See our privacy policy.