US2023190865A1PendingUtilityA1
VIP Antagonists and Uses in Treating Cancer
Est. expiryApr 23, 2038(~11.7 yrs left)· nominal 20-yr term from priority
A61P 35/00C07K 16/2818C07K 16/2827A61K 38/16A61K 2039/505A61K 38/25A61K 38/2278C07K 2317/76A61K 39/3955
59
PatentIndex Score
0
Cited by
0
References
0
Claims
Abstract
This disclosure relates to methods of treating cancer or viral infections comprising administering an effective amount of a VIP antagonist in combination with an immune check-point inhibitor to a subject in need thereof. In certain embodiments, the immune check-point inhibitor is an anti-PD1 or anti-PDL1 antibody.
Claims
exact text as granted — not AI-modified1 . A method of treating a cancer in a subject comprising
obtaining a T cell; exposing the T cell in vitro or ex vivo to a vasoactive intestinal polypeptide (VIP) antagonist and an immune check-point inhibitor thereby expanding the T cell; and administering an effective amount of the expanded T cell to the subject.
2 . The method of claim 1 , further comprising exposing the T cell in vitro or ex vivo to an anti-CD3 antibody, an anti-CD28 antibody, and/or a tumor antigen.
3 . The method of claim 1 , wherein the T cell is obtained from the subject.
4 . The method of claim 1 , wherein T cell is a senescent T cell prior to the in vitro or ex vivo exposure.
5 . The method of claim 1 , wherein the T cell is activated after the in vitro or ex vivo exposure.
6 . The method of claim 1 , further comprising administering to the subject an effective amount of a VIP antagonist.
7 . The method of claim 1 , further comprising administering to the subject an effective amount of an immune check-point inhibitor.
8 . The method of claim 7 , wherein the immune check-point inhibitor is an anti-PD1 antibody or an anti-PDL1 antibody.
9 . The method of claim 8 , wherein the anti-PD1 antibody is pembrolizumab or nivolumab.
10 . The method of claim 8 , wherein the anti-PDL1 antibody is atezolizumab, avelumab, or durvalumab.
11 . The method of claim 7 , wherein the immune check-point inhibitor is ipilimumab.
12 . The method of claim 1 , wherein the vasoactive intestinal polypeptide antagonist is composed of the sequence (SEQ ID NO: 1) KPRRPYTDNYTRLRKQMAVKKYLNSILN.
13 . The method of claim 1 , wherein the VIP antagonist is selected from the group consisting of
[Ac-Tyr1,D-Phe2]GRF 1-29, amide, i.e., (SEQ ID NO: 4)
YFDAIFTNSYRKVLGQLSARKLLQDIMSR (Modifications: Tyr-1=N-terminal Ac, Phe-2=D-Phe, Arg-29=C-terminal amide);
VIP (6-28), i.e., (SEQ ID NO:5) FTDNYTRLRKQMAVKKYLNSILN (Modifications: Asn-23=C-terminal amide); [D-p-Cl-Phe6, Leu17]-VIP, i.e., (SEQ ID NO: 6)
HSDAVFTDNYTRLRKQLAVKKYLNSILN (Modifications: Phe-6=p-Cl-D-Phe, Asn=C-terminal amide);
N-terminal Stearyl, Norleucine 17 VIPhyb, i.e., (SEQ ID NO: 9)
KPRRPYTDNYTRLRKQXAVKKYLNSILN, wherein X is norleucine;
Ac His1 [D-Phe(2), Lys(15), Arg(16), Leu(27)]-VIP(1-7)/GRF(8-27), i.e., (SEQ ID NO:10) HFDAVFTNSYRKVLKRLSARKLLQDIL, C-terminal amide; and pituitary adenylate cyclase-activating polypeptide, PACAP (6-38) C-terminal amide, i.e., (SEQ ID NO:11) TDSYSRYRKQMAVKKYLAAVLGKRYKQRVKNK.
14 . The method of claim 1 , wherein the VIP antagonist is conjugated with a nanoparticle.
15 . A method of enhancing an immune response to a cancer in a subject or treating a cancer in a subject, the method comprising administering to the subject an effective amount of a vasoactive intestinal peptide signalling (VIP) antagonist, an immune check-point inhibitor, and an anti-cancer antibody to a subject in need thereof.
16 . The method of claim 15 , wherein the immune check-point inhibitor is an anti-PD-1 antibody or an anti-PD-L1 antibody.
17 . The method of claim 16 , wherein the anti-PD1 antibody is pembrolizumab or nivolumab.
18 . The method of claim 16 , wherein the anti-PDL1 antibody is atezolizumab, avelumab, or durvalumab.
19 . The method of claim 15 , wherein the immune check-point inhibitor is ipilimumab.
20 . The method of claim 15 , wherein the anti-cancer antibody is selected from an anti-CD19 antibody, an anti-CD123 antibody, an anti-HER2/neu antibody, an anti-BMCA antibody, and an anti-EGFR antibody.
21 . The method of claim 15 , wherein the VIP antagonist is composed of the sequence (SEQ ID NO: 1) KPRRPYTDNYTRLRKQMAVKKYLNSILN.
22 . The method of claim 15 , wherein the VIP antagonist is selected from the group consisting of
[Ac-Tyr1,D-Phe2]GRF 1-29, amide, i.e., (SEQ ID NO: 4)
YFDAIFTNSYRKVLGQLSARKLLQDIMSR (Modifications: Tyr-1=N-terminal Ac, Phe-2=D-Phe, Arg-29=C-terminal amide);
VIP (6-28), i.e., (SEQ ID NO:5) FTDNYTRLRKQMAVKKYLNSILN (Modifications: Asn-23=C-terminal amide);
[D-p-Cl-Phe6, Leu17]-VIP, i.e., (SEQ ID NO: 6)
HSDAVFTDNYTRLRKQLAVKKYLNSILN (Modifications: Phe-6=p-Cl-D-Phe, Asn=C-terminal amide);
N-terminal Stearyl, Norleucine 17 VIPhyb, i.e., (SEQ ID NO: 9)
KPRRPYTDNYTRLRKQXAVKKYLNSILN, wherein X is norleucine;
Ac His1 [D-Phe(2), Lys(15), Arg(16), Leu(27)]-VIP(1-7)/GRF(8-27), i.e., (SEQ ID NO:10) HFDAVFTNSYRKVLKRLSARKLLQDIL, C-terminal amide; and pituitary adenylate cyclase-activating polypeptide, PACAP (6-38) C-terminal amide, i.e., (SEQ ID NO:11) TDSYSRYRKQMAVKKYLAAVLGKRYKQRVKNK.
23 . The method of claim 15 , wherein the VIP antagonist is conjugated to a nanoparticle.Join the waitlist — get patent alerts
Track US2023190865A1 — get alerts on status changes and closely related new filings.
We store only your email — no account needed. See our privacy policy.