US2024041977A1PendingUtilityA1
Annexin a1 n-terminal peptide formulations and methods
Est. expiryAug 21, 2040(~14 yrs left)· nominal 20-yr term from priority
A61P 29/00A61K 38/1709A61K 9/08A61K 47/26C07K 14/4721A61K 47/10A61K 9/19A61K 9/0019A61K 47/02A61P 1/16
35
PatentIndex Score
0
Cited by
0
References
0
Claims
Abstract
The present invention relates to pharmaceutical formulations comprising a therapeutically effective amount of an Annexin A1 (AnxA1) N-terminal-peptide having improved solubility and/or stability, while retaining agonistic activity at one or more of the formyl peptide receptors, including FPR1, FPR2 and FPR3.5
Claims
exact text as granted — not AI-modified1 . A liquid pharmaceutical formulation of pH>6.0; said formulation comprising
a. an Annexin A1 (AnxA1) N-terminal-peptide selected from the group consisting of
(SED ID NO: 4; Annexin A1 2-50)
AMVSEFLKQAWFIENEEQEYVQTVKSSKGGPGSAVSPYPTFNPSSD
VAA,
(SED ID NO: 5; Annexin A1 2-48)
AMVSEFLKQAWFIENEEQEYVQTVKSSKGGPGSAVSPYPTFNPSSD
V,
(SED ID NO: 6; Annexin A1 2-46)
AMVSEFLKQAWFIENEEQEYVQTVKSSKGGPGSAVSPYPTFNPSS,
(SED ID NO: 7; Annexin A1 2-50 V24L)
AMVSEFLKQAWFIENEEQEYVQT L KSSKGGPGSAVSPYPTFNPSSD
VAA,
(SED ID NO: 8; Annexin A1 2-48 V24L)
AMVSEFLKQAWFIENEEQEYVQT L KSSKGGPGSAVSPYPTFNPSSD
V,
and
(SED ID NO: 9; Annexin A1 2-46 V24L)
AMVSEFLKQAWFIENEEQEYVQT L KSSKGGPGSAVSPYPTFNPSS,
and a variant of any one of SEQ ID NOs:4-9 comprising 1 to 6 individual amino acid substitutions, wherein said variant is a ligand and/or agonist of one or more of Formyl Peptide Receptor 1 (FPR1), Formyl Peptide Receptor 2 (FPR2) and Formyl Peptide Receptor 3 (FPR3); and
b. a solvent selected from the group consisting of
i. water; and
ii. a solution having an ionic strength of 1 uM to 50 mM, wherein said solvent comprises one or more isotonicity modifiers selected from a carbohydrate and/or a sugar alcohol.
2 . The liquid pharmaceutical formulation according to claim 1 , wherein pH≥7.4.
3 - 4 . (canceled)
5 . The liquid pharmaceutical formulation according to claim 1 , wherein pH is 8 to 8.5.
6 - 8 . (canceled)
9 . The liquid pharmaceutical formulation according to claim 1 , wherein the Annexin A1 N-terminal-peptide has an aqueous solubility of at least 0.1 mg/ml.
10 . (canceled)
11 . The liquid pharmaceutical formulation according to claim 1 , said formulation having a concentration of said Annexin A1 N-terminal-peptide of 0.1 to 10 mg/ml.
12 - 23 . (canceled)
24 . The liquid pharmaceutical formulation according to claim 1 , wherein said isotonicity modifier is selected from the group consisting of pentose monosaccharides, hexose monosaccharides, disaccharides and trisaccharides.
25 . The liquid pharmaceutical formulation according to claim 1 , wherein said isotonicity modifier is selected from the group consisting of: sucrose, trehalose, mannose, ribose, maltose, glucose, lactose, galactose, arabinose, mannitol, sorbitol, inositol, glycerol, xylitol, propylene glycol, polyethylene glycols (PEGs) and polypropylene/ethylene glycol copolymer.
26 - 27 . (canceled)
28 . The liquid pharmaceutical formulation according to claim 1 , wherein the solvent comprises 3 to 5% (w/v) mannitol and/or 0.5 to 2% (w/v) sucrose.
29 - 35 . (canceled)
36 . The liquid pharmaceutical formulation according to claim 1 , further comprising one or more buffers selected from the group consisting of an acetate buffer, TRIS, amine-containing buffers, amino-acid based buffers, lysine, hydroxy-lysine, histidine and glycyl-glycine, non-phosphate buffers, bicarbonate buffers, Polysorbate-80 (e.g. Tween 80), HEPES and borate.
37 - 38 . (canceled)
39 . The liquid pharmaceutical formulation according to claim 1 , comprising approx. 4% mannitol, approx. 1% sucrose, approx. 10 mM glycylglycine, approx. 0.01% polysorbate 80, at a pH of approx. 8.3.
40 - 47 . (canceled)
48 . The liquid pharmaceutical formulation according to claim 1 , wherein said Annexin A1 N-terminal-peptide is
(SED ID NO: 8; Annexin A1 2-48 V24L)
AMVSEFLKQAWFIENEEQEYVQT L KSSKGGPGSAVSPYPTFNPSSDV-
NH 2 ,
49 - 55 . (canceled)
56 . The liquid pharmaceutical formulation according to claim 48 , wherein said Annexin A1 N-terminal-peptide is C-terminally amidated.
57 . The liquid pharmaceutical formulation according claim 1 , wherein pH is 8.2 to 8.4, said formulation comprising
i) 2 to 6 mg/mL of Annexin A1 2-48 V24L (SEQ ID NO: 8), ii) 3 to 5% (w/w) mannitol, iii) 0.5 to 2% (w/w) sucrose, iv) Polysorbate-80, and v) 1 to 20 mM glycyl-glycine.
58 . A method of treatment of an ischemic condition and/or an inflammatory condition, said method comprising one or more steps of administering a liquid pharmaceutical formulation according to claim 1 .
59 . A liquid pharmaceutical formulation of pH≥8; said formulation comprising
a. an Annexin A1 (AnxA1) N-terminal-peptide selected from the group consisting of
(SED ID NO: 4; Annexin A1 2-50)
AMVSEFLKQAWFIENEEQEYVQTVKSSKGGPGSAVSPYPTFNPSSD
VAA,
(SED ID NO: 5; Annexin A1 2-48)
AMVSEFLKQAWFIENEEQEYVQTVKSSKGGPGSAVSPYPTFNPSSD
V,
(SED ID NO: 6; Annexin A1 2-46)
AMVSEFLKQAWFIENEEQEYVQTVKSSKGGPGSAVSPYPTFNPSS,
(SED ID NO: 7; Annexin A1 2-50 V24L)
AMVSEFLKQAWFIENEEQEYVQTLKSSKGGPGSAVSPYPTFNPSSD
VAA,
(SED ID NO: 8; Annexin A1 2-48 V24L)
AMVSEFLKQAWFIENEEQEYVQTLKSSKGGPGSAVSPYPTFNPSSD
V,
and
(SED ID NO: 9; Annexin A1 2-46 V24L)
AMVSEFLKQAWFIENEEQEYVQTLKSSKGGPGSAVSPYPTFNPSS,
and a variant of any one of SEQ ID NOs:4-9 comprising 1 to 6 individual amino acid substitutions, wherein said variant is a ligand and/or agonist of one or more of Formyl Peptide Receptor 1 (FPR1), Formyl Peptide Receptor 2 (FPR2) and Formyl Peptide Receptor 3 (FPR3); and
b. a solvent, wherein said solvent is a solution having an ionic strength of 1 uM to 50 mM.
60 . The liquid pharmaceutical formulation according to claim 59 , wherein the Annexin A1 N-terminal-peptide has an aqueous solubility of at least 0.1 mg/ml.
61 . The liquid pharmaceutical formulation according to claim 59 , said formulation having a concentration of said Annexin A1 N-terminal-peptide of 0.1 to 10 mg/ml.
62 . The liquid pharmaceutical formulation according to claim 59 , wherein said Annexin A1 N-terminal-peptide is
(SED ID NO: 8; Annexin A1 2-48 V24L)
AMVSEFLKQAWFIENEEQEYVQT L KSSKGGPGSAVSPYPTFNPSSDV-
NH 2 ,
63 . The liquid pharmaceutical formulation according to claim 62 , wherein said Annexin A1 N-terminal-peptide is C-terminally amidated.
64 . The liquid pharmaceutical formulation according to claim 59 , wherein said solvent comprises one or more isotonicity modifiers selected from a carbohydrate and/or a sugar alcohol.Join the waitlist — get patent alerts
Track US2024041977A1 — get alerts on status changes and closely related new filings.
We store only your email — no account needed. See our privacy policy.