USRE46707EActiveUtility

Variants of C-type natriuretic peptide

56
Assignee: BIOMARIN PHARM INCPriority: May 20, 2009Filed: Jan 23, 2015Granted: Feb 13, 2018
Est. expiryMay 20, 2029(~2.9 yrs left)· nominal 20-yr term from priority
A61P 9/04A61P 9/12A61P 9/10A61P 7/10A61P 9/00A61P 21/00A61P 13/12A61P 19/00A61P 19/08G01N 2800/385A61K 47/10A61K 47/22A61K 9/08C07K 14/58G01N 2800/10A61K 47/26G01N 2800/52A61K 38/2242A61K 38/00A61K 47/60A61K 38/22G01N 2333/58A61K 47/20G01N 2800/105A61K 47/48215A61K 9/19C12N 15/70
56
PatentIndex Score
0
Cited by
120
References
17
Claims

Abstract

The present disclosure provides variants of C-type natriuretic peptide (CNP), pharmaceutical compositions comprising CNP variants, and methods of making CNP variants. The CNP variants are useful as therapeutic agents for the treatment of diseases responsive to CNP, including but not limited to bone-related disorders, such as skeletal dysplasias (e.g., achondroplasia), and vascular smooth muscle disorders (e.g., restenosis and arteriosclerosis).

Claims

exact text as granted — not AI-modified
What is claimed is: 
     
       1. A variant of C-type natriuretic peptide (CNP) selected from the group consisting of: 
       
         
           
                 
               
                   (SEQ ID NO: 179) 
                 
                   GDLRVDTKSRAAWARLLQEHPNARKYKGANKKGLSKGCFGLKLDRIGSMS 
                 
                   GLGC (Gly-CNP53); 
                 
                     
                 
                   (SEQ ID NO: 185) 
                 
                   PDLRVDTKSRAAWARLLQEHPNARKYKGANKKGLSKGCFGLKLDRIGSMS 
                 
                   GLGC (Pro-CNP53); 
                 
                     
                 
                   (SEQ ID NO: 190) 
                 
                   MDLRVDTKSRAAWARLLQEHPNARKYKGANKKGLSKGCFGLKLDRIGSMS 
                 
                   GLGC (Met-CNP53) 
                 
                     
                 
                   (SEQ ID NO: 180) 
                 
                   DLRVDTKSRAAWARLLQEHPNARKYKGANKKGLSKGCFGLKLDRIGSNS 
                 
                   GLGC [CNP-53(M48N)]. 
                 
             
                
                
                
                
                
                
                
                
                
                
                
                
                
                
                
               
            
           
         
       
       
        
       
     
     
       2. A pharmaceutical composition comprising a CNP variant of claim  1  15, and a pharmaceutically acceptable excipient, carrier or diluent. 
     
     
       3. The composition of  claim 2 , which is a lyophilized formulation prepared from a formulation that comprises a citric acid/citrate buffer or an acetic acid/acetate buffer having a pH from about 4 to about 6. 
     
     
       4. The composition of  claim 3 , wherein the lyophilized formulation is prepared from a formulation that further comprises (a) an isotonicity-adjusting agent or a bulking agent or (b) an antioxidant. 
     
     
       5. A method of treating a bone-related disorder or skeletal dysplasia, comprising administering a CNP variant to a subject in need thereof, wherein the CNP variant is a CNP variant according to claim  1  15, and wherein the bone-related disorder or skeletal dysplasia is selected from the group consisting of achondroplasia, hypochondroplasia, short stature, dwarfism and homozygous achondroplasia. 
     
     
       6. A method for recombinant production of a CNP variant, comprising culturing in a medium a host cell comprising a first polynucleotide encoding a CNP variant polypeptide linked to a second polynucleotide encoding a cleavable peptide or protein under conditions that result in expression of a fusion polypeptide encoded by the polynucleotides, wherein the fusion polypeptide comprises the CNP variant polypeptide directly linked to the cleavable peptide or protein or indirectly linked thereto via a linker, wherein the CNP variant is selected from the group consisting of: 
       
         
           
                 
               
                   (SEQ ID NO: 179) 
                 
                   GDLRVDTKSRAAWARLLQEHPNARKYKGANKKGLSKGCFGLKLDRIGSMS 
                 
                   GLGC (Gly-CNP53); 
                 
                     
                 
                   (SEQ ID NO: 185) 
                 
                   PDLRVDTKSRAAWARLLQEHPNARKYKGANKKGLSKGCFGLKLDRIGSMS 
                 
                   GLGC (Pro-CNP53); 
                 
                     
                 
                   (SEQ ID NO: 190) 
                 
                   MDLRVDTKSRAAWARLLQEHPNARKYKGANKKGLSKGCFGLKLDRIGSMS 
                 
                   GLGC (Met-CNP53); 
                 
                     
                 
                   (SEQ ID NO: 180) 
                 
                   DLRVDTKSRAAWARLLQEHPNARKYKGANKKGLSKGCFGLKLDRIGSNS 
                 
                   GLGC [CNP-53(M48N)]. 
                 
             
                
                
                
                
                
                
                
                
                
                
                
                
                
                
                
               
            
           
         
       
       
        
       
     
     
       7. The method of claim  6  16, wherein the cleavable peptide or protein is selected from the group consisting of histidine tags, human transcription factor TAF12, TAF12 fragments, TAF12 histone fold domain, mutants of TAF12 and fragments thereof, TAF12(C/A), TAF12(D/E), TAF12(4D/4E), TAF12(6D/6E), TAF12(10D/10E), TAF12(C/A & D/E), TAF12(C/A & 4D/4E), TAF12(C/A & 6D/6E), TAF12(C/A & 10D/10E), ketosteroid isomerase, maltose-binding protein, β-galactosidase, glutathione-S-transferase, thioredoxin, chitin-binding domain, BMP-2, BMP-2 mutants, BMP-2(C/A), and mutants and fragments thereof. 
     
     
       8. The method of claim  6  16, wherein the host cell is bacterial. 
     
     
       9. The method of claim  6  16, wherein the fusion polypeptide is expressed as a soluble protein or as an inclusion body. 
     
     
       10. The method of claim  6  16, further comprising isolating the expressed fusion polypeptide from the host cell or culture medium. 
     
     
       11. The method of  claim 10 , further comprising contacting the isolated fusion polypeptide with a cleaving agent selected from the group consisting of formic acid, cyanogen bromide (CNBr), hydroxylamine, protein self cleavage, Factor Xa, enterokinase, ProTEV, and SUMO protease. 
     
     
       12. A CNP variant produced according to the method of  claim 6 , wherein the CNP variant is selected from the group consisting of: 
       
         
           
                 
               
                   (SEQ ID NO: 179) 
                 
                   GDLRVDTKSRAAWARLLQEHPNARKYKGANKKGLSKGCFGLKLDRIGSMS 
                 
                   GLGC (Gly-CNP53)); 
                 
                     
                 
                   (SEQ ID NO: 185) 
                 
                   PDLRVDTKSRAAWARLLQEHPNARKYKGANKKGLSKGCFGLKLDRIGSMS 
                 
                   GLGC (Pro-CNP53)); 
                 
                     
                 
                   (SEQ ID NO: 190) 
                 
                   MDLRVDTKSRAAWARLLQEHPNARKYKGANKKGLSKGCFGLKLDRIGSMS 
                 
                   GLGC (Met-CNP53)); 
                 
                     
                 
                   (SEQ ID NO: 180) 
                 
                   DLRVDTKSRAAWARLLQEHPNARKYKGANKKGLSKGCFGLKLDRIGSNSG 
                 
                   LGC [CNP-53(M48N)]). 
                 
             
                
                
                
                
                
                
                
                
                
                
                
                
                
                
                
               
            
           
         
       
       
        
       
     
     
       13. A method of increasing long bone growth, comprising administering a CNP variant according to claim  1  15 to a subject in need thereof, where the administration increases long bone growth. 
     
     
       14. A CNP variant according to claim  1  15 useful for increasing long bone growth or treating achondroplasia, hypochondroplasia, short stature, dwarfism, or homozygous achondroplasia in a subject in need thereof. 
     
     
       15. A variant of C-type natriuretic peptide (CNP) selected from the group consisting of: 
       
         
           
                 
               
                   GDLRVDTKSRAAWARLLQEHPNARKYKGANKKGLSKGCFGLKLDRIGSM 
                 
                   SGLGC (SEQ ID NO: 179) (Gly-CNP53); 
                 
                     
                 
                   PDLRVDTKSRAAWARLLQEHPNARKYKGANKKGLSKGCFGLKLDRIGSM 
                 
                   SGLGC (SEQ ID NO: 185) (Pro-CNP53); 
                 
                     
                 
                   MDLRVDTKSRAAWARLLQEHPNARKYKGANKKGLSKGCFGLKLDRIGSM 
                 
                   SGLGC (SEQ ID NO: 190) (Met-CNP53); 
                 
                     
                 
                   DLRVDTKSRAAWARLLQEHPNARKYKGANKKGLSKGCFGLKLDRIGSNS 
                 
                   GLGC (SEQ ID NO: 180) [CNP-53(M48N)]; 
                 
             
                
                
                
                
                
                
                
                
                
                
                
               
            
           
         
       
       a CNP53 variant comprising a K4R mutation in the CNP22 portion of the peptide; 
       a CNP53 variant comprising a furin cleavage site mutation; 
       
         
           
                 
               
                   PEG-GDLRVDTKSRAAWARLLQEHPNARKYKGANKKGLSKGCFGLKLDR 
                 
                   IGSMSGLGC (SEQ ID NO: 179) (PEG-Gly-CNP53); 
                 
                     
                 
                   PEG-PDLRVDTKSRAAWARLLQEHPNARKYKGANKKGLSKGCFGLKLDR 
                 
                   IGSMSGLGC (SEQ ID NO: 185) (PEG-Pro-CNP53); 
                 
                     
                 
                   PEG-MDLRVDTKSRAAWARLLQEHPNARKYKGANKKGLSKGCFGLKLDR 
                 
                   IGSMSGLGC (SEQ ID NO: 190) (PEG-Met-CNP53); and 
                 
                     
                 
                   PEG-DLRVDTKSRAAWARLLQEHPNARKYKGANKKGLSKGCFGLKLDRI 
                 
                   GSNSGLGC (SEQ ID NO: 180) [PEG-CNP-53(M48N)]. 
                 
             
                
                
                
                
                
                
                
                
                
                
                
               
            
           
         
       
       
        
       
     
     
       16. A method for recombinant production of a CNP variant, comprising culturing in a medium a host cell comprising a first polynucleotide encoding a CNP variant polypeptide linked to a second polynucleotide encoding a cleavable peptide or protein under conditions that result in expression of a fusion polypeptide encoded by the polynucleotides, wherein the fusion polypeptide comprises the CNP variant polypeptide directly linked to the cleavable peptide or protein or indirectly linked thereto via a linker, wherein the CNP variant is selected from the group consisting of: 
       
         
           
                 
               
                   GDLRVDTKSRAAWARLLQEHPNARKYKGANKKGLSKGCFGLKLDRIGSM 
                 
                   SGLGC (SEQ ID NO: 179) (Gly-CNP53); 
                 
                     
                 
                   PDLRVDTKSRAAWARLLQEHPNARKYKGANKKGLSKGCFGLKLDRIGSM 
                 
                   SGLGC (SEQ ID NO: 185) (Pro-CNP53); 
                 
                     
                 
                   MDLRVDTKSRAAWARLLQEHPNARKYKGANKKGLSKGCFGLKLDRIGSM 
                 
                   SGLGC (SEQ ID NO: 190) (Met-CNP53); 
                 
                     
                 
                   DLRVDTKSRAAWARLLQEHPNARKYKGANKKGLSKGCFGLKLDRIGSNS 
                 
                   GLGC (SEQ ID NO: 180) [CNP-53(M48N)]; 
                 
             
                
                
                
                
                
                
                
                
                
                
                
               
            
           
         
       
       a CNP53 variant comprising a K4R mutation in the CNP22 portion of the peptide; and 
       a CNP53 variant comprising a furin cleavage site mutation. 
     
     
       17. A CNP variant produced according to the method of claim 16, wherein the CNP variant is selected from the group consisting of: 
       
         
           
                 
               
                   GDLRVDTKSRAAWARLLQEHPNARKYKGANKKGLSKGCFGLKLDRIGSM 
                 
                   SGLGC (SEQ ID NO: 179) (Gly-CNP53); 
                 
                     
                 
                   PDLRVDTKSRAAWARLLQEHPNARKYKGANKKGLSKGCFGLKLDRIGSM 
                 
                   SGLGC (SEQ ID NO: 185) (Pro-CNP53); 
                 
                     
                 
                   MDLRVDTKSRAAWARLLQEHPNARKYKGANKKGLSKGCFGLKLDRIGSM 
                 
                   SGLGC (SEQ ID NO: 190) (Met-CNP53); 
                 
                     
                 
                   DLRVDTKSRAAWARLLQEHPNARKYKGANKKGLSKGCFGLKLDRIGSNS 
                 
                   GLGC (SEQ ID NO: 180) [CNP-53(M48N)]; 
                 
             
                
                
                
                
                
                
                
                
                
                
                
               
            
           
         
       
       a CNP53 variant comprising a K4R mutation in the CNP22 portion of the peptide; and 
       a CNP53 variant comprising a furin cleavage site mutation.

Cited by (0)

No later patents cite this yet.

References (0)

No backward citations on record.